ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl02e08 |
|---|---|
| Clone Library Name | barley_pub |
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 106 bits (264), Expect = 2e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE+ ARSWTQKYAMG Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 106 bits (264), Expect = 2e-23 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYES ARSWTQKYAMG Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 105 bits (261), Expect = 3e-23 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE+ AR+WTQKYAMG Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 103 bits (258), Expect = 8e-23 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYES ARSWTQKYAMG Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 102 bits (255), Expect = 2e-22 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYES AR+WTQKYAMG Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 94.4 bits (233), Expect = 6e-20 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTDR++YE AR WT+KYA+ Sbjct: 97 LTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 94.4 bits (233), Expect = 6e-20 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICS+LTDPNPD+PLVPEIAH+YKTDRA+YE+ AR WT+KYA+ Sbjct: 97 LTISKVLLSICSMLTDPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147
>UBC4_YEAST (P15731) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 148 Score = 92.0 bits (227), Expect = 3e-19 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LT+SKVLLSICSLLTD NPDDPLVPEIAH+YKTDR KYE+ AR WT+KYA+ Sbjct: 98 LTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 148
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 90.5 bits (223), Expect = 9e-19 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICS+LTDPNPDDPLVPEIAH+Y+T RA+YE+ AR WT KYA+ Sbjct: 97 LTISKVLLSICSMLTDPNPDDPLVPEIAHVYRTARAQYEATAREWTPKYAI 147
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 90.1 bits (222), Expect = 1e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 90.1 bits (222), Expect = 1e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 90.1 bits (222), Expect = 1e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 90.1 bits (222), Expect = 1e-18 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UBC4_CANAL (P43102) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 89.4 bits (220), Expect = 2e-18 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLLTD NPDDPLVPEIAH+YK DR KYE+ A+ WT+KYA+ Sbjct: 97 LTISKVLLSICSLLTDANPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 89.4 bits (220), Expect = 2e-18 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR +Y AR WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM 147
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 89.0 bits (219), Expect = 3e-18 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY AR WT+KYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 147
>UBC5_YEAST (P15732) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 88.6 bits (218), Expect = 3e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LT+SKVLLSICSLLTD NPDDPLVPEIA +YKTD+AKYE+ A+ WT+KYA+ Sbjct: 98 LTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 88.6 bits (218), Expect = 3e-18 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY +R WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 88.6 bits (218), Expect = 3e-18 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY +R WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 88.6 bits (218), Expect = 3e-18 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY +R WTQKYAM Sbjct: 97 LTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 86.7 bits (213), Expect = 1e-17 Identities = 42/51 (82%), Positives = 43/51 (84%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LTISKVLLSI SLL DPNPDDPLVPEIA +YKTDR KY AR WTQKYAM Sbjct: 97 LTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LT+SKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY AR WTQKYAM Sbjct: 97 LTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 86.3 bits (212), Expect = 2e-17 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 LT+SKVLLSICSLL DPNPDDPLVP+IA +YK+D+ KY AR WTQKYAM Sbjct: 97 LTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
>UB2E2_MOUSE (Q91W82) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) Length = 201 Score = 69.7 bits (169), Expect = 2e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 151 LTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E2_HUMAN (Q96LR5) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) (UbcH8) Length = 201 Score = 69.7 bits (169), Expect = 2e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 151 LTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E1_MOUSE (P52482) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcM3) Length = 193 Score = 69.7 bits (169), Expect = 2e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 143 LTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UB2E1_HUMAN (P51965) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcH6) Length = 193 Score = 69.7 bits (169), Expect = 2e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 143 LTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UB2E3_MOUSE (P52483) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcM2) Length = 207 Score = 68.9 bits (167), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 157 LTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UB2E3_HUMAN (Q969T4) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcH9) (UbcM2) Length = 207 Score = 68.9 bits (167), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y T+RA+++ AR WT++YA Sbjct: 157 LTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UBCD2_DROME (P52485) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 232 Score = 63.9 bits (154), Expect = 9e-11 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTISKVLLSICSLLTD NP DPLV IA Y +R +++ AR WT++YA Sbjct: 182 LTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
>UBE2N_PONPY (Q5R7J6) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +LL+ PNPDDPL ++A +KT+ A+ AR+WT+ YAM Sbjct: 99 LQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_MOUSE (P61089) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +LL+ PNPDDPL ++A +KT+ A+ AR+WT+ YAM Sbjct: 99 LQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_MACFA (Q4R4I1) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +LL+ PNPDDPL ++A +KT+ A+ AR+WT+ YAM Sbjct: 99 LQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_HUMAN (P61088) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 55.8 bits (133), Expect = 2e-08 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +LL+ PNPDDPL ++A +KT+ A+ AR+WT+ YAM Sbjct: 99 LQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 55.8 bits (133), Expect = 2e-08 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I +LLSI +LL+ PNPDDPL ++A ++K + A+ AR WTQKYA+ Sbjct: 99 LQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYAV 149
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 54.7 bits (130), Expect = 5e-08 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L IS VL SI L+++PNPDDPL+ +I+ +K +RA + S A+ WT+K+A+ Sbjct: 102 LNISTVLTSIQLLMSEPNPDDPLMADISSEFKYNRAVFFSNAKKWTEKHAL 152
>UBE2N_RAT (Q9EQX9) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 54.3 bits (129), Expect = 7e-08 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +LL+ PNPDDPL ++A +K++ A+ AR+WT+ YAM Sbjct: 99 LQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARAWTRLYAM 149
>COP10_ARATH (Q9LJD7) Constitutive photomorphogenesis protein 10| Length = 182 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LTI+KVL +I S+ P P P +P IA +Y TDR K++ A+ WT ++A Sbjct: 132 LTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFA 181
>UBE2T_HUMAN (Q9NPD8) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 197 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/50 (44%), Positives = 35/50 (70%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 L I+ VL SI L+++PNPDDPL+ +I+ +K ++ + AR WT+K+A Sbjct: 102 LNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHA 151
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 49.3 bits (116), Expect = 2e-06 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L I VLLSI +L+ PNPDDPL ++A ++K + + + AR WT+KYA+ Sbjct: 98 LQIRTVLLSIQALMGAPNPDDPLDNDVAKIWKENEPQAIANAREWTKKYAV 148
>UBE2T_MOUSE (Q9CQ37) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/50 (40%), Positives = 33/50 (66%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 L I+ VL SI L+ +PNPDDPL+ +I+ +K ++ + A+ WT+ +A Sbjct: 102 LNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAKQWTEAHA 151
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 44.3 bits (103), Expect = 7e-05 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 L I VLLSI +LL PNP+DPL ++A + + ++ AR WT+ YA Sbjct: 99 LQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +T+ L+S+ +LL P P+DP E+A Y DR + A WT+ YA Sbjct: 100 ITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYA 149
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 L I ++ SI LL PNP+DP E+A +Y+ D+ Y+ R + + ++ Sbjct: 104 LNIISIIWSIIVLLDQPNPEDPFNSELASLYRNDKLSYDKKIRDYCKTHS 153
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 40.8 bits (94), Expect = 8e-04 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 +S +L SI SLL+DPNP+ P A +YK +R +YE ++ ++ Sbjct: 102 VSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQ 147
>UBC1_MOUSE (P61087) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +T+ VLLS+ +LL PDDP +A+ YK + ++ AR W YA Sbjct: 103 MTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_HUMAN (P61086) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +T+ VLLS+ +LL PDDP +A+ YK + ++ AR W YA Sbjct: 103 MTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_BOVIN (P61085) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +T+ VLLS+ +LL PDDP +A+ YK + ++ AR W YA Sbjct: 103 MTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL +PN DP E +Y +R +YE R+ +K+A Sbjct: 107 ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL +PN DP E +Y +R +YE R+ +K+A Sbjct: 107 ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL +PN DP E +Y +R +YE R+ +K+A Sbjct: 107 ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL +PN DP E +Y +R +YE R+ +K+A Sbjct: 107 ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL +PN DP E +Y +R +YE R+ +K+A Sbjct: 107 ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -1 Query: 377 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKY 243 +V+ S+ +L+ DP P+ PL ++A Y DR K+ A +T+KY Sbjct: 103 QVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -1 Query: 377 KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKY 243 +V+ S+ +L+ DP P+ PL ++A Y DR K+ A +T+KY Sbjct: 103 QVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR-----SWT 252 ++ +L SI SLL DPNP+ P E A MY ++ +Y R SWT Sbjct: 102 VAAILTSIQSLLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 150
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 38.5 bits (88), Expect = 0.004 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR-----SWT 252 ++ +L SI SLL DPNP+ P E A MY + +Y R SWT Sbjct: 102 VAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWT 150
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 38.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +TI ++LL I LL DPN P E M+K D+ +YE R+ ++ A Sbjct: 107 ITIKQILLGIQDLLDDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENA 156
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 37.7 bits (86), Expect = 0.007 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG 234 +T+ VLLS+ +LL PDDP +A+ +K + A+ WT YA G Sbjct: 104 MTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGG 155
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 37.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ESPARSWTQ 249 +S +L SI SLL DPN P E A++YK R++Y E+ SW + Sbjct: 102 VSSILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIKRVRETVENSWNE 151
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 37.4 bits (85), Expect = 0.009 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR-----SWT 252 ++ +L SI SLL DPNP+ P E A M+ ++ +Y R SWT Sbjct: 102 VAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWT 150
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 37.0 bits (84), Expect = 0.011 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 5/48 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ESPARSW 255 ++ VL SI SLL DPN P E +++YK +R +Y E+ RSW Sbjct: 102 VAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRREYIKRVRETVERSW 149
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ VL SI SLL DPN P E +++YK +R +Y R +K Sbjct: 102 VAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRKEYTKRVRETVEK 147
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 ++I ++L+ I LL PN +DP E +Y +RA+YE + KYA Sbjct: 107 ISIKQLLIGIQDLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYA 156
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 37.0 bits (84), Expect = 0.011 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR-----SWT 252 ++ +L SI SLL DPNP+ P E A M+ + +Y R SWT Sbjct: 102 VAAILTSIQSLLCDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWT 150
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 +S +L SI SLL +PNP+ P + A +Y+ ++ +YE Sbjct: 102 VSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 36.6 bits (83), Expect = 0.015 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR-----SWT 252 ++ +L S+ SLL DPN P E + +YK R +YE R SWT Sbjct: 102 VAAILTSVQSLLNDPNTSSPANVEASMLYKDHRQQYEKRVRDTVEASWT 150
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 36.2 bits (82), Expect = 0.020 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ +L SI SLL DPN P E +++YK +R +Y R +K Sbjct: 102 VAAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEK 147
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 36.2 bits (82), Expect = 0.020 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DP E A + DRA YE + + +KYA Sbjct: 110 LLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEKYA 147
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 276 ++ VL SI SLL DPNPD P E A ++ ++ +Y Sbjct: 102 VAAVLTSIQSLLCDPNPDSPANAEAARLFSENKREY 137
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 35.8 bits (81), Expect = 0.025 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DPL E A + DR YE + + +KYA Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYA 147
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 35.8 bits (81), Expect = 0.025 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DPL E A + DR YE + + +KYA Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYA 147
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 35.4 bits (80), Expect = 0.033 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ESPARSW 255 +S +L S+ SLL DPN P E A++YK R+ Y E+ SW Sbjct: 102 VSSILTSVQSLLNDPNISSPANVEAANLYKDHRSLYVKRVRETVENSW 149
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 35.0 bits (79), Expect = 0.043 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ESPARSWTQ 249 ++ +L SI SLL DPN P E +++Y+ +R +Y E+ +SW + Sbjct: 102 VAAILTSIQSLLNDPNTSSPANVEASNLYRDNRKEYIKRVRETVEKSWEE 151
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 35.0 bits (79), Expect = 0.043 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIA-----HMYKTDRAKYESPARSWTQK 246 I VLLS+ SLL +PNPD P + A ++YK D Y + +K Sbjct: 107 IDTVLLSVISLLNEPNPDSPANVDAAKSYRKYLYKEDLESYPMEVKKTVKK 157
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 34.3 bits (77), Expect = 0.074 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIA-----HMYKTDRAKYESPARSWTQK 246 I +LLS+ SLL +PNPD P + A ++YK D Y + +K Sbjct: 107 IDTILLSVISLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKK 157
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 34.3 bits (77), Expect = 0.074 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 276 ++ +L SI SLL DPNP+ P E A +Y+ + +Y Sbjct: 102 VAAILTSIQSLLHDPNPNSPANAEAASLYRENMKEY 137
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 34.3 bits (77), Expect = 0.074 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DPL E A + D+ YE+ + + ++YA Sbjct: 110 LLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYA 147
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 34.3 bits (77), Expect = 0.074 Identities = 14/40 (35%), Positives = 26/40 (65%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYES 270 L I+ ++ + L +PNP+DPL E A + +T+R ++E+ Sbjct: 120 LNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFEN 159
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 34.3 bits (77), Expect = 0.074 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 ++ +L SI SLL +PNP+ P A +Y+ +R +YE Sbjct: 102 VAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYE 138
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 LTI+ ++ + L +PNP+DPL E A + + +R +E Sbjct: 123 LTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFE 161
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 LTI+ ++ + L +PNP+DPL E A + + +R +E Sbjct: 123 LTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFE 161
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 LTI+ ++ + L +PNP+DPL E A + + +R +E Sbjct: 123 LTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFE 161
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 LTI+ ++ + L +PNP+DPL E A + + +R +E Sbjct: 123 LTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFE 161
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 ++ +L S+ SLL DPNP P + A ++K + +YE Sbjct: 102 VAAILTSVQSLLNDPNPASPANVDAAQLFKENLKEYE 138
>UB2G2_PONPY (Q5RF84) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ K+LLS+ S+L +PN + + + M++ DR ++ A+ QK Sbjct: 115 SVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_MOUSE (P60605) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ K+LLS+ S+L +PN + + + M++ DR ++ A+ QK Sbjct: 115 SVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UB2G2_HUMAN (P60604) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ K+LLS+ S+L +PN + + + M++ DR ++ A+ QK Sbjct: 115 SVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 T+ +LLS+ S+LTDPN + P + A M + + A+++ Sbjct: 114 TVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFK 151
>UBC21_CAEEL (P52484) Probable ubiquitin-conjugating enzyme E2 21 (EC 6.3.2.19)| (Ubiquitin-protein ligase 21) (Ubiquitin carrier protein 21) Length = 260 Score = 33.1 bits (74), Expect = 0.17 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LT+ VLLS+ ++L P P DP +A + + + + A WT +A Sbjct: 133 LTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTSYFA 182
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 33.1 bits (74), Expect = 0.17 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKY 243 +TI+++ + I LL +PN +P E +Y +R +YE R+ +K+ Sbjct: 107 ITINQLFIGIQELLNEPNIQEPAQAEAYTIYCQNRVEYEKRFRAQAKKF 155
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 32.0 bits (71), Expect = 0.37 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DPL + A MY +Y+ + + QKYA Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYA 149
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 32.0 bits (71), Expect = 0.37 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 353 LLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 LL PNP DPL + A MY +Y+ + + QKYA Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYA 149
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 32.0 bits (71), Expect = 0.37 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 362 ICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 I LL +PN DPL E A + D+ YE + + KYA Sbjct: 107 IPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYA 147
>UBC7_SCHPO (O00102) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 166 Score = 31.6 bits (70), Expect = 0.48 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ K+LLS+ S+L +PN + + M++ DR +Y R +K Sbjct: 116 SVEKILLSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARK 162
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR 285 T+ +++S+ S+L DPN D P + A ++ DR Sbjct: 115 TVETIMISVISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR 285 T+ +++S+ S+L DPN D P + A ++ DR Sbjct: 115 TVETIMISVISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR 285 T+ +++S+ S+L DPN D P + A ++ DR Sbjct: 115 TVETIMISVISMLADPNGDSPANVDAAKEWREDR 148
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 276 T+ ++LSI S+L+ PN + P E A ++ +RA++ Sbjct: 116 TVESIVLSIISMLSGPNDESPANVEAAKEWRDNRAEF 152
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 30.8 bits (68), Expect = 0.82 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 ++ VL SI SLL DPN +++YK +R +Y R +K Sbjct: 102 VAAVLTSIQSLLNDPNTGSRANVAPSNLYKDNRKEYHKRVRETVEK 147
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 30.8 bits (68), Expect = 0.82 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 T+ VL+SI SLL DPN + P + A Y+ + +Y+ Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYK 157
>COBQ_DESVH (Q72DW3) Cobyric acid synthase| Length = 543 Score = 30.8 bits (68), Expect = 0.82 Identities = 22/64 (34%), Positives = 27/64 (42%) Frame = +3 Query: 81 VHSYEFNRGTTTSKVHFTSSRGGGILLAGHLGDNGSGLGASMVTSWPLQALAHGVLLCPG 260 VH YE + G TT + GG +L+ H D GS G + HGV G Sbjct: 429 VHGYEIHHGVTT-----PDAGGGAVLVCLHESD-GSPAGWTTPDGQVWGTYLHGVFDADG 482 Query: 261 ARRG 272 RRG Sbjct: 483 FRRG 486
>UBE2C_MOUSE (Q9D1C1) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRA 282 + +LLSI SLL +PN D PL A ++K A Sbjct: 128 VRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTA 161
>UBE2C_HUMAN (O00762) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRA 282 + +LLSI SLL +PN D PL A ++K A Sbjct: 128 VRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTA 161
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 276 ++ +L SI SLL DPN P E A +++ ++ +Y Sbjct: 102 VAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEY 137
>CT091_HUMAN (Q5T1J6) Protein C20orf91| Length = 154 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/51 (29%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 239 WRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQG--SGPSATNRLTGGPLIW 385 W G TW Q C C P H G S P + ++L L+W Sbjct: 67 WNVEEEEHEVGISTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVW 117
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 T+ ++LSI S+L+ PN + P E A ++ R +++ +K Sbjct: 115 TVESIMLSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRK 161
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 T+ ++LSI S+L+ PN + P E A ++ R +++ +K Sbjct: 115 TVESIMLSIISMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRK 161
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYA 240 +T+ +++L + LL PNP+ P + ++A+Y+ ++Y+ Sbjct: 107 ITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKAEYDKKVLLQAKQYS 156
>ATG20_YEAST (Q07528) Sorting nexin-42 (Autophagy-related protein 20) (Cytoplasm| to vacuole targeting protein 20) Length = 640 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 28 ETSGRTDYPDPTDLTWQEYIHTSSTGARQPQ 120 +TS TD+ DP + W E++++SST + P+ Sbjct: 286 KTSIITDFLDPNNHNWHEFVNSSSTFSSLPK 316
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 + +LLS+ SLL +PN PL + A ++ D +Y+ Sbjct: 127 VQTILLSLQSLLGEPNNASPLNAQAAELWSKDPIEYK 163
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR 261 L + ++L + SL +PN +DPL E A + D+ ++ + R Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVR 170
>UB2EC_XENLA (P56616) Ubiquitin-conjugating enzyme X (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UBC-X) Length = 179 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRA 282 + +LLS+ SLL +PN + PL P A +++ A Sbjct: 128 VRTILLSLQSLLGEPNNESPLNPYAAELWQNQTA 161
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAMG*SLEGPAG 210 L I VLL+I LL PNP+ L E + + +Y + AR T+ + GP+G Sbjct: 107 LGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHG---GAGGPSG 163
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQK 246 T+ ++LSI S+L+ PN + P E A ++ + +++ R +K Sbjct: 117 TVESIVLSIISMLSSPNDESPANIEAAKDWREKQDEFKKKVRRAVRK 163
>NDKM_HUMAN (O00746) Nucleoside diphosphate kinase, mitochondrial precursor (EC| 2.7.4.6) (NDP kinase, mitochondrial) (NDK) (nm23-H4) (Nucleoside diphosphate kinase D) (NDPKD) Length = 187 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 67 LTWQEYIHTSSTGARQPQKSISLRHGGGGYFW 162 L W+ + G R P S+ +RHG GG W Sbjct: 4 LFWRSALRGLRCGPRAPGPSLLVRHGSGGPSW 35
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 L+++ V++ + L +PN DPL + AH +R +++ Sbjct: 118 LSLNAVMIGLQYLFLEPNASDPLNKDAAHQMTANREEFK 156
>MINC_SYNEL (Q8DHE3) Probable septum site-determining protein minC| Length = 266 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 389 LTISKVLLSICSLLT-DPNPDDPLVPEIAHMYKTDRAKYESPARSWTQKYAM 237 L ++ L I LL P+P P PE+A Y TD+ +PA +W + +A+ Sbjct: 213 LEMAATQLRIADLLARTPDPPRPPYPEVA--YATDQGIQIAPAYTWGRVFAV 262
>GPA1_ORYSA (P49083) Guanine nucleotide-binding protein alpha-1 subunit| (GP-alpha-1) (Protein Dwarf1) Length = 380 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 I KV LS+C D P P E+ H Y+ + K+E Sbjct: 297 IQKVPLSVCEWFKDYQPIAPGKQEVEHAYEFVKKKFE 333
>CLAP1_HUMAN (Q7Z460) CLIP-associating protein 1 (Cytoplasmic linker-associated| protein 1) (Multiple asters homolog 1) Length = 1538 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPD--DPLVPEIAHMYK 294 LT+SK++ IC+LL DPN D + + +Y+ Sbjct: 163 LTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYR 196
>L100_ADEG1 (Q64760) Late 100 kDa protein| Length = 984 Score = 28.5 bits (62), Expect = 4.1 Identities = 21/69 (30%), Positives = 29/69 (42%) Frame = +1 Query: 31 TSGRTDYPDPTDLTWQEYIHTSSTGARQPQKSISLRHGGGGYFWLVI*GITVLGSGHPWS 210 T G+ Y DP +T T +RQP+ + +H G G T G+ + Sbjct: 806 TKGKGVYKDP---------NTGETISRQPRDTARAQHAGDGQALPAPGAYTTGGNRAETA 856 Query: 211 PAGPSRL*P 237 PAG RL P Sbjct: 857 PAGAVRLAP 865
>ZBT10_HUMAN (Q96DT7) Zinc finger and BTB domain-containing protein 10 (Zinc| finger protein RIN ZF) Length = 847 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 141 RGGGILLAGHLGDNGSGLGASMVTSWPLQ 227 RGGG G LG+NGS G + WPL+ Sbjct: 126 RGGG---GGGLGNNGSSRGRPETSVWPLR 151
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPARSWTQ 249 L I VLL+I LL PNP+ L E + + +Y + AR T+ Sbjct: 107 LGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTE 153
>KR134_HUMAN (Q3LI77) Keratin-associated protein 13-4| Length = 160 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -2 Query: 382 YQRSSCQSVRC*RTRTLMILWCPRSLTCTRLIGPSTSPRRAPGHKS 245 ++ +SCQ C R RT IL CP TC+ +G +S R+ G+ S Sbjct: 56 WEPASCQK-SCYRPRT-SILCCPCQTTCSGSLGFRSSSCRSQGYGS 99
>KCNH4_HUMAN (Q9UQ05) Potassium voltage-gated channel subfamily H member 4| (Voltage-gated potassium channel subunit Kv12.3) (Ether-a-go-go-like potassium channel 1) (ELK channel 1) (ELK1) (Brain-specific eag-like channel 2) (BEC2) Length = 1017 Score = 28.1 bits (61), Expect = 5.3 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = -3 Query: 318 ARDRSHVQD*SGQVRVPGALLDTKVRHGLEPGGASW*PWMPRAQNRYPLNDQPKVSPPPV 139 +R V S ++R LL ++ P G++W P P Q R P PPP Sbjct: 888 SRLNQEVSQLSRELRHIMGLLQARLGPPGHPAGSAWTPDPPCPQLRPPCLSPCASRPPPS 947 Query: 138 TK*NGLLRLSCP 103 + L + CP Sbjct: 948 LQDTTLAEVHCP 959
>CLCN1_RAT (P35524) Chloride channel protein, skeletal muscle (Chloride channel| protein 1) (ClC-1) Length = 994 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 269 PARSWTQKYAMG*SLEGPAGDHGCPEPRTVIP*MTSQKYPPP 144 PA SW P G+ G PE ++P M PPP Sbjct: 909 PAESWNV----------PEGEDGAPEREVMVPTMPETPVPPP 940
>CLCN1_MOUSE (Q64347) Chloride channel protein, skeletal muscle (Chloride channel| protein 1) (ClC-1) Length = 994 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 269 PARSWTQKYAMG*SLEGPAGDHGCPEPRTVIP*MTSQKYPPP 144 PA SW P G+ G PE ++P M PPP Sbjct: 909 PAESWNV----------PEGEDGAPEREVMVPTMPETPVPPP 940
>HEXB_FELCA (P49614) Beta-hexosaminidase beta chain precursor (EC 3.2.1.52)| (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Hexosaminidase B) Length = 531 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 239 WRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQGSGPSATNRLT 367 W FV + R WP S ER +P+D G +A NRLT Sbjct: 463 WGEFVDATNLTPRLWPRASAVGERLWSPEDITSVG-NAYNRLT 504
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR 261 L I+ V+ + L T+PN +DPL + A + + + +E+ R Sbjct: 125 LNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVR 167
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -1 Query: 389 LTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESPAR 261 L I+ V+ + L T+PN +DPL E A + + + +E R Sbjct: 126 LNINTVIYGLFHLFTEPNYEDPLNHEAAAVLRDNPKTFEYNVR 168
>SECF_BORBU (O51597) Protein-export membrane protein secF| Length = 299 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 11/53 (20%) Frame = -2 Query: 139 DEVKWTFEVVVPLLNSYECTLAMSSPLGLGSLF-----------YLTFRYLLS 14 D++K TF+ + +L+SY + SS L + S+F Y+T R+ LS Sbjct: 111 DKLKETFDANIEVLDSYFIDSSFSSTLRIRSIFLVLGTFILILIYITLRFKLS 163
>IF2_RHOBA (Q7URR0) Translation initiation factor IF-2| Length = 1038 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 132 TSSRGGGIL--LAGHLGDNGSGLGASMVTSWPLQALAHGVLLCPGARRGL 275 +S++GGG+ +AG +G+N SG PL A+ G R L Sbjct: 228 SSNKGGGLASRIAGRMGNNSSGRVVPNTPGTPLSAVRRDSASAGGKMRSL 277
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 383 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 276 + +LLS+ SLL +PN PL A ++ D +Y Sbjct: 107 VETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEY 142
>ZN592_HUMAN (Q92610) Zinc finger protein 592| Length = 1267 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +1 Query: 46 DYPDPTDLTWQEYIHTSSTGARQPQK--------SISLRHGG 147 D PDPT L +E I T S P K S+SL H G Sbjct: 17 DIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSG 58
>VG43_ICHV1 (Q00161) Hypothetical gene 43 protein| Length = 891 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = -1 Query: 356 SLLTDPNPDDPLVPEIAHMYKTDRAKYES 270 SLL+ + D+P+ E+ +M+ D+ +Y++ Sbjct: 780 SLLSQVSEDEPVTSELINMFSLDKVRYDT 808
>CXA3_BOVIN (P41987) Gap junction alpha-3 protein (Connexin-44) (Cx44)| Length = 406 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = -3 Query: 351 ADGPEP**SFGARDRSHVQD*SGQVRVPGALLDTKV 244 A GPE G +D + V+D G+VR+ GALL T V Sbjct: 115 AAGPE-----GHQDPAPVRDDRGKVRIAGALLRTYV 145
>PDE3A_RAT (Q62865) cGMP-inhibited 3',5'-cyclic phosphodiesterase A (EC| 3.1.4.17) (Cyclic GMP-inhibited phosphodiesterase A) (CGI-PDE A) Length = 1141 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = +2 Query: 221 PPG-----SSPWRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQGSGPSATN 358 PPG SS W T + SA G T +RS + K H+ PSA N Sbjct: 427 PPGLLRRVSSTWTT--TTSATGLPTLEPAPVRRDRSASIKPHEAPSPSAVN 475
>PDE3A_MOUSE (Q9Z0X4) cGMP-inhibited 3',5'-cyclic phosphodiesterase A (EC| 3.1.4.17) (Cyclic GMP-inhibited phosphodiesterase A) (CGI-PDE A) Length = 1141 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = +2 Query: 221 PPG-----SSPWRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQGSGPSATN 358 PPG SS W T + SA G T +RS + K H+ PSA N Sbjct: 427 PPGLLRRVSSTWTT--TTSATGLPTLEPAPVRRDRSASIKPHEAPSPSAVN 475
>APAH_PSEAE (Q9I5U7) Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC| 3.6.1.41) (Diadenosine tetraphosphatase) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) Length = 283 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 206 GHQLAPPGSSPWRTFVSRSAPGTR 277 G APPG +PW +F SR G + Sbjct: 200 GLDTAPPGYAPWFSFPSRKTRGEK 223
>PUR2_NEIMB (Q9JXA3) Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS)| (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) Length = 423 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 63 GLDMARVHSYEFNRGTTTSKVHFTSSRGGGILLAGHLGDN 182 GLD A F+ GTT ++ + GG +L LGDN Sbjct: 351 GLDAANQIGKVFHAGTTANEKGDVLTNGGRVLCVVGLGDN 390
>PUR2_NEIMA (Q9JWU6) Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS)| (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) Length = 423 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 63 GLDMARVHSYEFNRGTTTSKVHFTSSRGGGILLAGHLGDN 182 GLD A F+ GTT ++ + GG +L LGDN Sbjct: 351 GLDAANQVGKVFHAGTTANEKGDVLTNGGRVLCVVGLGDN 390
>EXOB_AZOBR (Q59083) UDP-glucose 4-epimerase (EC 5.1.3.2) (UDP-galactose| 4-epimerase) (Galactowaldenase) Length = 348 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 43 TDYPDPTDLTWQEYIHTSSTGARQPQKSISLRHGGG 150 TDY P ++YIH S + LR GGG Sbjct: 218 TDYDTPDGTCIRDYIHVSDLADAHVLALLHLRRGGG 253
>UBC7_YEAST (Q02159) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 165 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = -1 Query: 386 TISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 273 ++ K+LLS+ S+L++PN + + +++ +R ++E Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFE 152
>LMBTL_HUMAN (Q9Y468) Lethal(3)malignant brain tumor-like protein (L(3)mbt-like)| (L(3)mbt protein homolog) (H-l(3)mbt protein) (H-L(3)MBT) (L3MBTL1) Length = 772 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 46 DYPDPTDLTWQEYIHTSSTGA 108 DYPDP + W++Y+ + A Sbjct: 415 DYPDPDNFCWEKYLEETGASA 435
>CO2A1_RAT (P05539) Collagen alpha-1(II) chain precursor [Contains:| Chondrocalcin] Length = 1419 Score = 27.3 bits (59), Expect = 9.1 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = +2 Query: 197 GIHGHQLAPPGSSPWRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQGSGPSATNRLTGGP 376 G G + P G+ P R APG R +P Q AP + SG + G P Sbjct: 421 GKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDP 480
>CO2A1_MOUSE (P28481) Collagen alpha-1(II) chain precursor [Contains:| Chondrocalcin] Length = 1459 Score = 27.3 bits (59), Expect = 9.1 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = +2 Query: 197 GIHGHQLAPPGSSPWRTFVSRSAPGTRTWPDQSCTCERSRAPKDHQGSGPSATNRLTGGP 376 G G + P G+ P R APG R +P Q AP + SG + G P Sbjct: 461 GKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDP 520 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,315,926 Number of Sequences: 219361 Number of extensions: 1613311 Number of successful extensions: 4506 Number of sequences better than 10.0: 151 Number of HSP's better than 10.0 without gapping: 4269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4497 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
