Clone Name | rbastl02c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MUC1_HUMAN (P15941) Mucin-1 precursor (MUC-1) (Polymorphic epith... | 29 | 3.8 | 2 | KAIN_PONPY (Q5RCR2) Kallistatin precursor (Serpin A4) | 28 | 5.0 | 3 | KAIN_HUMAN (P29622) Kallistatin precursor (Serpin A4) (Kallikrei... | 28 | 5.0 |
---|
>MUC1_HUMAN (P15941) Mucin-1 precursor (MUC-1) (Polymorphic epithelial mucin)| (PEM) (PEMT) (Episialin) (Tumor-associated mucin) (Carcinoma-associated mucin) (Tumor-associated epithelial membrane antigen) (EMA) (H23AG) (Peanut-reactive urinary mucin) (PUM) Length = 1255 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 86 RDIITVAVTRLAGFKRSPQHSKATTAADNKPLAGFNRSP 202 +D+ +V VTR A +P T+A DNKP G P Sbjct: 96 QDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPP 134
>KAIN_PONPY (Q5RCR2) Kallistatin precursor (Serpin A4)| Length = 427 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 2 NIIGFGVRTRVGANLF*HHKLAFSHGIQRDIITVAVTRL 118 N+ G G+ TRVG+ LF H L F D +T +L Sbjct: 129 NLPGHGLETRVGSALFLSHNLKFLAKFLNDTMTFYEAKL 167
>KAIN_HUMAN (P29622) Kallistatin precursor (Serpin A4) (Kallikrein inhibitor)| (Protease inhibitor 4) Length = 427 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 2 NIIGFGVRTRVGANLF*HHKLAFSHGIQRDIITVAVTRL 118 N+ G G+ TRVG+ LF H L F D + V +L Sbjct: 129 NLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKL 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,996,563 Number of Sequences: 219361 Number of extensions: 379208 Number of successful extensions: 844 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)