Clone Name | rbastl02b03 |
---|---|
Clone Library Name | barley_pub |
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 195 FLPNL*QCTVVLEYSVGYNISCQHCRSRKLN 103 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349
>OXAA_RICPR (Q9ZE97) Inner membrane protein oxaA| Length = 560 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 221 PPMVLFLFSSYPICNNVLWFW-SILSV 144 P + LF+FSS+P+ + W W +ILS+ Sbjct: 524 PLIFLFMFSSFPVGLLIYWSWNNILSI 550
>OXAA_RICCN (Q92JJ3) Inner membrane protein oxaA| Length = 560 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 221 PPMVLFLFSSYPICNNVLWFW-SILSV 144 P + LF+FSS+P+ + W W +ILS+ Sbjct: 524 PLIFLFMFSSFPVGLLIYWSWNNILSI 550
>ZDHC2_HUMAN (Q9UIJ5) Palmitoyltransferase ZDHHC2 (EC 2.3.1.-) (Zinc finger DHHC| domain-containing protein 2) (DHHC-2) (Zinc finger protein 372) (Reduced expression associated with metastasis protein) (Ream) (Reduced expression in cancer protein) (Rec) Length = 367 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = -2 Query: 211 YYFFSVLTQFVTMYCGFGVFCRLQYIV----SAL*ESKTEFKIILAYYCQPHFSV 59 Y FF + + +YC F LQY + + L +++ +F I+ ++ FSV Sbjct: 169 YKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSV 223
>ZDHC2_RAT (Q9JKR5) Palmitoyltransferase ZDHHC2 (EC 2.3.1.-) (Zinc finger DHHC| domain-containing protein 2) (DHHC-2) Length = 366 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = -2 Query: 211 YYFFSVLTQFVTMYCGFGVFCRLQYIV----SAL*ESKTEFKIILAYYCQPHFSV 59 Y FF + + +YC F LQY + + L +++ +F I+ ++ FSV Sbjct: 168 YKFFLLFLAYSLLYCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSV 222
>ZDHC2_MOUSE (P59267) Palmitoyltransferase ZDHHC2 (EC 2.3.1.-) (Zinc finger DHHC| domain-containing protein 2) (DHHC-2) Length = 366 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = -2 Query: 211 YYFFSVLTQFVTMYCGFGVFCRLQYIV----SAL*ESKTEFKIILAYYCQPHFSV 59 Y FF + + +YC F LQY + + L +++ +F I+ ++ FSV Sbjct: 168 YKFFLLFLAYSLLYCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSV 222
>OXAA_BACTN (Q8AA76) Inner membrane protein oxaA| Length = 618 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 245 VKWDVFVSPPMVLFLFSSYPICNNVLWFWSIL 150 +KW +++ P M LF+ + YP N +F S L Sbjct: 528 MKWMMYLMPIMFLFVLNDYPSGLNYYYFVSTL 559
>SEN54_ASHGO (Q74ZJ5) tRNA-splicing endonuclease subunit SEN54 (tRNA-intron| endonuclease SEN54) Length = 455 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = +1 Query: 16 DQLPTQK---KNKIKPSKPRNEADSNKPK 93 D +PT++ +NKI PS+P + DS K K Sbjct: 359 DGMPTREFMQRNKIAPSQPHSGGDSRKKK 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,826,440 Number of Sequences: 219361 Number of extensions: 719616 Number of successful extensions: 1671 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1671 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)