| Clone Name | rbastl02a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IF2_LACAC (Q5FJN6) Translation initiation factor IF-2 | 30 | 2.3 | 2 | P85B_BOVIN (P23726) Phosphatidylinositol 3-kinase regulatory bet... | 28 | 8.6 | 3 | NCAP_CVTNC (Q9PZ49) Nucleocapsid protein (N structural protein) ... | 28 | 8.6 |
|---|
>IF2_LACAC (Q5FJN6) Translation initiation factor IF-2| Length = 877 Score = 30.4 bits (67), Expect = 2.3 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 2 KSKDVAAANKERLEFIKTTRNNPPAFKLLQFFKESVRAWESRIHR 136 +S D A NKER K+ P A LLQ FK+ RA E +++R Sbjct: 102 RSSDRARDNKER--DAKSNTGRPKAAALLQQFKQKQRAEEGQLNR 144
>P85B_BOVIN (P23726) Phosphatidylinositol 3-kinase regulatory beta subunit| (PI3-kinase p85-beta subunit) (PtdIns-3-kinase p85-beta) Length = 724 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 425 RRHNIPGTSDHLIFVPISCVRSGHVSRAPRPLPISVWCRPPTP 297 +R + PGT + P++ R G R PRPLP PP P Sbjct: 66 QRGDFPGTYVEFLG-PVALARPGPRPRGPRPLPARPRDGPPEP 107
>NCAP_CVTNC (Q9PZ49) Nucleocapsid protein (N structural protein) (NC)| Length = 409 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = +3 Query: 249 LHRYRFPRGTYRNISSWRRWPAPDGDR*RTGSSRDVSGAHARDRYEDEMIGGS 407 LHR R R T + ++ R P+ DG R R S D A A +D+ GS Sbjct: 160 LHRGRSGRSTAASSAASSRAPSRDGSRGRRSGSEDDLIARAAKIIQDQQKKGS 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,918,456 Number of Sequences: 219361 Number of extensions: 1412345 Number of successful extensions: 3427 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3427 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)