Clone Name | rbastl01h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SODM_SCHPO (Q9UQX0) Superoxide dismutase [Mn], mitochondrial pre... | 31 | 0.88 | 2 | DPOL_ADEB2 (O72539) DNA polymerase (EC 2.7.7.7) | 30 | 1.2 | 3 | YKF1_YEAST (P35735) Hypothetical 40.5 kDa protein in NUP120-CSE4... | 30 | 2.0 | 4 | Y441_MYCPN (P75337) Hypothetical protein MPN441 (H08_orf102) | 29 | 2.6 | 5 | LAMA5_MOUSE (Q61001) Laminin alpha-5 chain precursor | 28 | 7.5 | 6 | LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor | 27 | 9.8 |
---|
>SODM_SCHPO (Q9UQX0) Superoxide dismutase [Mn], mitochondrial precursor (EC| 1.15.1.1) Length = 218 Score = 30.8 bits (68), Expect = 0.88 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = -3 Query: 322 SPWGSVASTADWRRRVSAPLV*IPEGVGWDFVVVDEDGVL 203 S WGS+ D+++ ++A L I +G GW +++VD+DG L Sbjct: 125 SKWGSLE---DFQKEMNAALASI-QGSGWAWLIVDKDGSL 160
>DPOL_ADEB2 (O72539) DNA polymerase (EC 2.7.7.7)| Length = 1017 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = +1 Query: 181 EGAIITYIKLRLHLQQ---QNPIQPPPVF 258 EGA TYIK RL QQ +NPI P P+F Sbjct: 9 EGATFTYIKGRLIKQQAAVENPILPFPIF 37
>YKF1_YEAST (P35735) Hypothetical 40.5 kDa protein in NUP120-CSE4 intergenic| region Length = 353 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 124 FSPFLFICDTCCFFLEYIMSERIYSSIHTM 35 F F+F+ TCC EY + R Y+S+H + Sbjct: 167 FVVFMFL-STCCLIAEYFLMGRHYASVHPL 195
>Y441_MYCPN (P75337) Hypothetical protein MPN441 (H08_orf102)| Length = 102 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 127 FFSPFLFICDTCCFFLEYIMSERIYSSIHTMTPTIYI 17 F++PF+++ CCF I S + S + PT ++ Sbjct: 53 FWTPFVWLPSCCCFGFSSIASSPLTSCFQRLLPTFWL 89
>LAMA5_MOUSE (Q61001) Laminin alpha-5 chain precursor| Length = 3718 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 5/61 (8%) Frame = +1 Query: 163 VCASQHEGAIITYIKLRLHLQQQNPIQPPPVFTRGGQ-----ILFGANQQLTPHCPMATA 327 +C + EG ++ + L++ +P+QPP T + +L G +++ AT Sbjct: 2993 LCLAVQEGTLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATV 3052 Query: 328 F 330 F Sbjct: 3053 F 3053
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +1 Query: 163 VCASQHEGAIITYIKLRLHLQQQNPIQPPPVFTRGGQ-----ILFGANQQLTPHCPMATA 327 +C + EG+++ L++ P+QPPP T + +L G+ +++ AT Sbjct: 2989 LCLAVQEGSLVLLYDFGAGLKKAVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATV 3048 Query: 328 F 330 + Sbjct: 3049 Y 3049 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,827,956 Number of Sequences: 219361 Number of extensions: 758629 Number of successful extensions: 2244 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2242 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)