Clone Name | rbastl01h09 |
---|---|
Clone Library Name | barley_pub |
>SATB2_MOUSE (Q8VI24) DNA-binding protein SATB2 (Special AT-rich| sequence-binding protein 2) Length = 733 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 15 HSHSWV*MVQFITIPITMVPEDQSYPKKENSTMRLRRPNPP 137 HS +VQ P+ ++ QS P KE+S R P PP Sbjct: 564 HSERMQHVVQLPPEPVQVLHRQQSQPTKESSPPREEAPPPP 604
>SATB2_HUMAN (Q9UPW6) DNA-binding protein SATB2 (Special AT-rich| sequence-binding protein 2) Length = 733 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 15 HSHSWV*MVQFITIPITMVPEDQSYPKKENSTMRLRRPNPP 137 HS +VQ P+ ++ QS P KE+S R P PP Sbjct: 564 HSERMQHVVQLPPEPVQVLHRQQSQPAKESSPPREEAPPPP 604
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 101 KFNHAVATSESTEIRKRNRKGSKKVPT 181 +F+ A+ + E+RKR RK K+VPT Sbjct: 207 EFDFALEERDELELRKRTRKVQKEVPT 233
>COX18_YEAST (P53239) Inner membrane protein COX18, mitochondrial precursor| (Cytochrome c oxidase assembly protein 18) Length = 316 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 137 EIRKRNRKGSKK--VPTWMNALTAGIQISL 220 E RKR +K KK VP W NAL +QI L Sbjct: 147 ETRKRQKKLFKKYNVPLWKNALLPMVQIPL 176
>FXR1_MOUSE (Q61584) Fragile X mental retardation syndrome-related protein 1| Length = 677 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 60 ITMVPEDQSYPKKENSTMRLRRPNPPKLEKEIEKG 164 +T+V E+ P+++ +R P PP ++KEI +G Sbjct: 28 LTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEG 62
>FXR1_HUMAN (P51114) Fragile X mental retardation syndrome-related protein 1| Length = 621 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 60 ITMVPEDQSYPKKENSTMRLRRPNPPKLEKEIEKG 164 +T+V E+ P+++ +R P PP ++KEI +G Sbjct: 28 LTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEG 62
>FXR1_CRIGR (O70523) Fragile X mental retardation syndrome-related protein 1| Length = 621 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 60 ITMVPEDQSYPKKENSTMRLRRPNPPKLEKEIEKG 164 +T+V E+ P+++ +R P PP ++KEI +G Sbjct: 28 LTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEG 62
>YBL7_YEAST (P38213) Protein YBR007C| Length = 736 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 75 EDQSYPKKENSTMRLRRPNPPKLEK-EIEKGRKRFLH 182 +D YP EN RPNP EK IE R L+ Sbjct: 189 KDYKYPNLENGNRSTNRPNPFNFEKYRIENTRLHHLY 225
>PSD2_YEAST (P53037) Phosphatidylserine decarboxylase proenzyme 2 precursor (EC| 4.1.1.65) [Contains: Phosphatidylserine decarboxylase 2 beta chain; Phosphatidylserine decarboxylase 2 alpha chain] Length = 1138 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 308 CSPVCVILIGAFFSAKDGSAMRASTAW 228 C+PVC + F+S K ++T W Sbjct: 37 CNPVCFVTTNTFYSQKTNKLKNSNTHW 63
>FBX16_MOUSE (Q9QZM9) F-box only protein 16| Length = 334 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 101 KFNHAVATSESTEIRKRNRKGSKKVPTWMNA 193 K + ++A S+ +RK+N G K++P W ++ Sbjct: 192 KQSPSLAFRSSSSLRKKNNPGEKELPPWRSS 222
>MADCA_MOUSE (Q61826) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (mMAdCAM-1) Length = 405 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 60 ITMVPEDQSYPKKENSTMRLRRPNPPKLEKEIEKG 164 IT +P YPK T+ P PK+ +++E G Sbjct: 254 ITTLPSAPPYPKLSPRTLSSEGPCRPKIHQDLEAG 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,527,325 Number of Sequences: 219361 Number of extensions: 805838 Number of successful extensions: 1884 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1884 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)