Clone Name | rbastl01h06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RF1_ORYSA (Q76C99) Rf1 protein, mitochondrial precursor (PPR pro... | 31 | 1.1 | 2 | ECM1_HUMAN (Q16610) Extracellular matrix protein 1 precursor (Se... | 29 | 4.1 | 3 | POL4_DROME (P10394) Retrovirus-related Pol polyprotein from tran... | 29 | 4.1 | 4 | SYGA_HELPY (P56453) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 28 | 9.2 |
---|
>RF1_ORYSA (Q76C99) Rf1 protein, mitochondrial precursor (PPR protein)| (Fertility restorer) (Restorer for CMS) Length = 791 Score = 31.2 bits (69), Expect = 1.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 427 TFDIMVHGFCKHGSRSEAERWMEAMYRNGFYPTWYTMRL 311 TF+IM+ K G EA+ A NG P ++T RL Sbjct: 653 TFNIMIDALLKVGRNDEAKDLFVAFSSNGLVPNYWTYRL 691
>ECM1_HUMAN (Q16610) Extracellular matrix protein 1 precursor (Secretory| component p85) Length = 540 Score = 29.3 bits (64), Expect = 4.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 322 CTKWDRTRFGTLPPSTFQPHFCCHACRSHVP 414 CT+ RF QPH+ AC SH P Sbjct: 259 CTRQGEARFSCFQEEAPQPHYQLRACPSHQP 289
>POL4_DROME (P10394) Retrovirus-related Pol polyprotein from transposon 412| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1237 Score = 29.3 bits (64), Expect = 4.1 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = -1 Query: 79 DIW*SYFCYCFLITQGM----NPLRFIFG 5 D+W YF YCF TQ M P +FG Sbjct: 1089 DVWLQYFVYCFNTTQSMVHNYCPYELVFG 1117
>SYGA_HELPY (P56453) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 303 Score = 28.1 bits (61), Expect = 9.2 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +2 Query: 290 SQGCIVVQPHSVPSG 334 +QGC+V+QP+ +P+G Sbjct: 17 NQGCLVIQPYDIPAG 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,758,772 Number of Sequences: 219361 Number of extensions: 1188954 Number of successful extensions: 2516 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2514 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)