Clone Name | rbastl01g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LEF4_NPVAC (P41477) Late expression factor 4 | 32 | 0.47 | 2 | SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouc... | 28 | 6.8 | 3 | YR061_MIMIV (Q5UPD3) Putative BTB/POZ domain and WD-repeat prote... | 27 | 8.9 | 4 | SEY1_SCHPO (Q9UTE0) Protein sey1 | 27 | 8.9 | 5 | POLG_CX16G (Q65900) Genome polyprotein [Contains: Coat protein V... | 27 | 8.9 | 6 | SYL_UREPA (Q9PQC0) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 27 | 8.9 |
---|
>LEF4_NPVAC (P41477) Late expression factor 4| Length = 464 Score = 31.6 bits (70), Expect = 0.47 Identities = 24/89 (26%), Positives = 40/89 (44%) Frame = +3 Query: 60 KVSYYNNFSS*LYPQDFLHHVLNMYIIDNTRILQRYTYSYKKKNWCFSRTQ*SC*CYLAT 239 ++SY NFS QD L+ +LN YI+ N + Q+Y Y + + T Sbjct: 11 EISYSINFS-----QDLLYKILNSYIVPNYSLAQQYFDLYDENGF-------------RT 52 Query: 240 RLA*QHVKTDLLEQLVHTH*KKKLKMLIW 326 R+ Q +++ + T+ K K K + W Sbjct: 53 RIPIQSACNNIISSVKKTNSKHK-KFVYW 80
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 50 RHNKSVILQQLQFLTVPPGLPAPRAKYVHHRQHAH 154 +H + +LQQ L P A +++HH QH H Sbjct: 175 QHPHAALLQQHPHLLQNPQFLAAAQQHMHHHQHQH 209
>YR061_MIMIV (Q5UPD3) Putative BTB/POZ domain and WD-repeat protein R61| Length = 496 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 123 LNMYIIDNTRILQRYTYSYKKKNWCFSRTQ*SC*C 227 + ++ IDN +++ + YK + CFS SC C Sbjct: 233 IKLWNIDNREVIKEFQCDYKINDICFSPDGKSCVC 267
>SEY1_SCHPO (Q9UTE0) Protein sey1| Length = 762 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/33 (30%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 111 LHHVLNMYI-IDNTRILQRYTYSYKKKNWCFSR 206 + +++ Y+ ID+T+ + Y ++KK +W F R Sbjct: 499 IKNIVPFYVDIDDTKTTEEYIINFKKNSWLFFR 531
>POLG_CX16G (Q65900) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 41 VQFRHNKSVILQQLQFLTVPPGLPAPRAK 127 V + N ++ Q LQ++ VPPG P P ++ Sbjct: 702 VAAKPNGELVPQLLQYMYVPPGAPKPTSR 730
>SYL_UREPA (Q9PQC0) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 806 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 117 HVLNMYIIDNTRILQRYTYSYKKKNWCFSR 206 +VLN Y+I N L + +YK +NW FSR Sbjct: 394 NVLNDYLIKNH--LGKKVANYKLRNWIFSR 421 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,327,724 Number of Sequences: 219361 Number of extensions: 934634 Number of successful extensions: 2012 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2010 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)