Clone Name | rbastl01g09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (O... | 29 | 3.7 | 2 | VGLP_BEV (P23052) Peplomer glycoprotein precursor | 29 | 4.9 | 3 | RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1 | 29 | 4.9 |
---|
>RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 29.3 bits (64), Expect = 3.7 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +2 Query: 128 GAYNTEL*HQEGTNISKCHWRHKGFR*QTVHQHQNSRKTDTSSHFANLHYKWTFLAGHLA 307 GAY+ E H + + K WR + H N +H + + +F A HL Sbjct: 212 GAYHHEFSHLQSVKVGKIKWRDPK---DGLLGHLNYTHEQVDTHTVTVQLQESFAANHLY 268 Query: 308 LEQRGS 325 +RG+ Sbjct: 269 CIRRGN 274
>VGLP_BEV (P23052) Peplomer glycoprotein precursor| Length = 1581 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = -3 Query: 216 TVCYLKPLCLQWHLEMFVPS*CHNSVLYAPDAIFL*VGELCFFTFGTIIIGWQY 55 T+C+ P FV C+N+ LY PDA+F T + + W Y Sbjct: 334 TLCFGSPF--------FVAQECYNNALYLPDAVFT--------TLFSTLFSWDY 371
>RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1| Length = 1269 Score = 28.9 bits (63), Expect = 4.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 188 SSGI*RCLYLLDVIIQCYMHLTPSFYELVNYV 93 +S I C Y L+ + YM+ TP +E+VN++ Sbjct: 1086 ASNIKACQYTLETLCHMYMNDTPMKFEIVNHM 1117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,720,564 Number of Sequences: 219361 Number of extensions: 1053749 Number of successful extensions: 2239 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2238 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)