Clone Name | rbastl01f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HIRA_MOUSE (Q61666) HIRA protein (TUP1-like enhancer of split pr... | 28 | 6.6 |
---|
>HIRA_MOUSE (Q61666) HIRA protein (TUP1-like enhancer of split protein 1)| Length = 1015 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 282 WNL---LVSPCDLAGSTTH--QGFYCPSGRQLLSRSSFNRGGGGHRVV 410 W L + PCD G TTH + + P G L+S + N G +++ Sbjct: 206 WQLETSITKPCDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQII 253 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,097,806 Number of Sequences: 219361 Number of extensions: 1323423 Number of successful extensions: 2511 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2511 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)