Clone Name | rbastl01f01 |
---|---|
Clone Library Name | barley_pub |
>YDDA_ECOLI (P31826) Inner membrane ABC transporter ATP-binding protein yddA| (CDS102) Length = 561 Score = 30.8 bits (68), Expect = 0.83 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +1 Query: 160 VPISPSLSLQPELCIWKP*WRKKSVKHKTGVLYGMTILSMLL 285 +PI+ + + LC+ KP W +K+ +KT VL + IL+M+L Sbjct: 4 IPITLRMLIAKYLCLLKPFWLRKN--NKTSVLLIIIILAMIL 43
>COQ9A_XENLA (Q3B8B2) Ubiquinone biosynthesis protein COQ9-A, mitochondrial| precursor Length = 317 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 199 IILVAKRAREILVQPFFLVPFSLW 128 ++L+ R R +L+QPF L+P W Sbjct: 17 LLLMVARRRPVLMQPFLLMPRKFW 40
>PYR1_DICDI (P20054) Protein PYR1-3 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2185 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 105 SVPAAILRH-NENGTKKKGCTNISLALFATRIMYMETLVAKKKCQA 239 S+P I++ NE G ++K TNI L T ++Y+ T V K++ Q+ Sbjct: 2069 SMPTEIIKELNEKGIEQKEYTNIESILPTTNVLYV-TRVQKERFQS 2113
>FUSC3_FUSCU (Q8J1X7) Allergen Fus c 3| Length = 450 Score = 28.1 bits (61), Expect = 5.4 Identities = 22/65 (33%), Positives = 26/65 (40%) Frame = -1 Query: 209 FHIHNSGCKESEGDIGTAFFFGSVFVVAQDSCGHTASVCKFAFWSHPTYTQPRMMMNE*M 30 FH ++ S TA F G V DS GH AS K SH + P +NE Sbjct: 201 FHYEHNIVSPSSIHPSTAHFDGEVPSQWDDSLGHGASTPKVRTPSHHVSSNPWAEINEPT 260 Query: 29 DGRVD 15 G D Sbjct: 261 GGDND 265
>LEP4_LEGPN (O68433) Type 4 prepilin-like proteins leader peptide-processing| enzyme [Includes: Leader peptidase (EC 3.4.23.43) (Prepilin peptidase); N-methyltransferase (EC 2.1.1.-)] Length = 287 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 56 VVYKLGVTKRRIYKR*QCARSYPAPQRKRNQKKRLYQYLPRSLC 187 ++Y+L + + +K QC + QRK +K +L +LPRS C Sbjct: 31 IIYRLPIILQEEWKE-QCCELFHFEQRK--EKIKLNLFLPRSFC 71
>MRAY_LACAC (Q5FKV4) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 322 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = -1 Query: 248 PVLCLTLFFRH*GFHIHNSGCKESEGDIGTAFFFGSVFVVAQDSCGHTASVCKFAFWSH 72 PVL + H G I + G K + GT G++FV+A SV A W H Sbjct: 23 PVLINFMHSHHEGQEIRDEGPKWHQKKSGTPTMGGTIFVIAA-----VISVIWVAAWQH 76
>YHJ6_YEAST (P38770) Hypothetical 53.4 kDa protein in SLT2-PUT2 intergenic| region Length = 471 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +2 Query: 92 YKR*QCARSYPAPQRKRNQKKRL-YQYLPRSLCNQNYVYGNPSGEKKVSSTKP 247 +K Q A ++ + KR + R YQ + S NY Y + G K S TKP Sbjct: 207 HKSSQYANAFDSEIIKRELRSRSKYQPIQVSFNTHNYFYSDKDGIKTYSLTKP 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,091,193 Number of Sequences: 219361 Number of extensions: 1201095 Number of successful extensions: 3074 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3074 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)