ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl01e04 |
|---|---|
| Clone Library Name | barley_pub |
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 62.0 bits (149), Expect = 3e-10 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPA 262 KC +PGH SR+CP YG S GG T CYKC + GH +RDCP+ Sbjct: 226 KCGKPGHISRECPEAGGSYGGSRGGGDRT--CYKCGEAGHISRDCPS 270 Score = 58.5 bits (140), Expect = 4e-09 Identities = 31/73 (42%), Positives = 37/73 (50%), Gaps = 6/73 (8%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ------GVGQER 241 +C + GH SRDCP A P G A CYKC Q GH +RDCP+ G GQ+R Sbjct: 74 RCGEAGHMSRDCPNSAKP------GAAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKR 127 Query: 240 QMYVNGAASGGYN 202 A GGY+ Sbjct: 128 G---RSGAQGGYS 137 Score = 52.4 bits (124), Expect = 3e-07 Identities = 24/56 (42%), Positives = 27/56 (48%), Gaps = 10/56 (17%) Frame = -3 Query: 402 KCNQPGHFSRDCP----------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 KC Q GH SRDCP GQ + GG + CYKC GH +RDCP Sbjct: 101 KCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCP 156 Score = 52.0 bits (123), Expect = 3e-07 Identities = 27/71 (38%), Positives = 36/71 (50%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNG 223 KC + GH SR+CP GS+ G+ CYKC +PGH +R+CP G G Sbjct: 200 KCGESGHMSRECPSA----GSTGSGDR---ACYKCGKPGHISRECPEAGGSY-------G 245 Query: 222 AASGGYNRQSY 190 + GG +R Y Sbjct: 246 GSRGGGDRTCY 256 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 KC GH SRDCP Y A CYKC + GH +R+CP+ G Sbjct: 172 KCGDAGHISRDCPNGQGGYSG-----AGDRKCYKCGESGHMSRECPSAG 215 Score = 49.3 bits (116), Expect = 2e-06 Identities = 28/71 (39%), Positives = 31/71 (43%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNG 223 KC GH SRDCP Y A CYKC GH +RDCP GQ G Sbjct: 144 KCGDAGHISRDCPNGQGGYSG-----AGDRTCYKCGDAGHISRDCPN---GQ-------G 188 Query: 222 AASGGYNRQSY 190 SG +R+ Y Sbjct: 189 GYSGAGDRKCY 199 Score = 47.8 bits (112), Expect = 6e-06 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 12/83 (14%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP-------AQG---- 256 +C + GH SR+CP +A G A C++C + GH +RDCP A+G Sbjct: 47 RCGEEGHMSRECPNEAR------SGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECY 100 Query: 255 -VGQERQMYVNGAASGGYNRQSY 190 GQE + + +S G +R Y Sbjct: 101 KCGQEGHLSRDCPSSQGGSRGGY 123 Score = 40.8 bits (94), Expect = 8e-04 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 C + GH++R+CP + G+ + C++C + GH +R+CP Sbjct: 21 CGKEGHYARECPEADSK------GDERSTTCFRCGEEGHMSRECP 59 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 309 CYKCNQPGHFARDCP-AQGVGQER 241 C C + GH+AR+CP A G ER Sbjct: 18 CRNCGKEGHYARECPEADSKGDER 41
>GRP2_NICSY (P27484) Glycine-rich protein 2| Length = 214 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = -3 Query: 402 KCNQPGHFSRDCP-----GQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 KC + GHF+RDC G +G GG G CYKC + GHFAR+C + G Sbjct: 161 KCGESGHFARDCSQSGGGGGGGRFGGGGGGGGGGG-CYKCGEDGHFARECTSGG 213 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = -3 Query: 363 GQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGG 208 G YG GG+ C+KC + GHFARDC G G + G GG Sbjct: 143 GGGGGYGG--GGSGGGSGCFKCGESGHFARDCSQSGGGGGGGRFGGGGGGGG 192
>GRP2B_ARATH (Q38896) Glycine-rich protein 2b (AtGRP2b)| Length = 201 Score = 52.4 bits (124), Expect = 3e-07 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 11/60 (18%) Frame = -3 Query: 402 KCNQPGHFSRDCP---------GQAAPYGSSVGGNANTG--LCYKCNQPGHFARDCPAQG 256 KC +PGH +R+C G YGS GG G CY C + GHFARDC + G Sbjct: 140 KCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGLSCYSCGESGHFARDCTSGG 199 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = -3 Query: 333 GGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 GG C+KC +PGH AR+C G G Y G G Y Sbjct: 130 GGGGGDNSCFKCGEPGHMARECSQGGGG-----YSGGGGGGRY 167
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 50.1 bits (118), Expect = 1e-06 Identities = 25/63 (39%), Positives = 30/63 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C QPGH S DCP V CY C QPGH +RDCP + +E + G Sbjct: 262 CQQPGHRSNDCPEPKKEREPRV--------CYNCQQPGHNSRDCPEERKPREGRNGFTGG 313 Query: 219 ASG 211 +SG Sbjct: 314 SSG 316 Score = 49.7 bits (117), Expect = 2e-06 Identities = 30/89 (33%), Positives = 39/89 (43%), Gaps = 7/89 (7%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQE-RQMYVNG 223 C QPGH S DCP V CY C QPGH +RDCP + +E R + +G Sbjct: 376 CQQPGHRSNDCPEPKKEREPRV--------CYNCQQPGHNSRDCPEERKPREGRNGFTSG 427 Query: 222 ------AASGGYNRQSYVGS*VVWPITCF 154 GG N + + + P+ CF Sbjct: 428 FGGGNDGGFGGGNAEGFGNNEERGPMKCF 456 Score = 38.5 bits (88), Expect = 0.004 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 24/69 (34%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAP------YGSSVGGNANTGL------------------CYKCNQ 292 C QPGH SRDCP + P + S GG + G C+ C Sbjct: 401 CQQPGHNSRDCPEERKPREGRNGFTSGFGGGNDGGFGGGNAEGFGNNEERGPMKCFNCKG 460 Query: 291 PGHFARDCP 265 GH + +CP Sbjct: 461 EGHRSAECP 469 Score = 36.6 bits (83), Expect = 0.015 Identities = 30/123 (24%), Positives = 39/123 (31%), Gaps = 56/123 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAP-----------------------------------------YG 343 C QPGH SRDCP + P +G Sbjct: 287 CQQPGHNSRDCPEERKPREGRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFG 346 Query: 342 SS-VGGNAN--------------TGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGG 208 S GGN+N C+ C QPGH + DCP +E ++ N G Sbjct: 347 SGGFGGNSNGFGSGGGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGH 406 Query: 207 YNR 199 +R Sbjct: 407 NSR 409 Score = 34.3 bits (77), Expect = 0.073 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -3 Query: 363 GQAAPYGSSVGGN---ANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGYNR 199 G + +GS GG C+ C QPGH + DCP +E ++ N G +R Sbjct: 238 GNSNGFGSGGGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGHNSR 295
>BYR3_SCHPO (P36627) Cellular nucleic acid-binding protein homolog| Length = 179 Score = 45.8 bits (107), Expect = 2e-05 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 KC + GH +RDC G GG+ + CY C GH ARDC Sbjct: 87 KCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDC 131 Score = 42.4 bits (98), Expect = 3e-04 Identities = 26/75 (34%), Positives = 30/75 (40%), Gaps = 6/75 (8%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG------VGQERQ 238 C GH RDCP P + CYKC + GH ARDC G G R Sbjct: 63 CGTAGHLVRDCPSSPNPRQGAE--------CYKCGRVGHIARDCRTNGQQSGGRFGGHRS 114 Query: 237 MYVNGAASGGYNRQS 193 +N A G Y Q+ Sbjct: 115 -NMNCYACGSYGHQA 128 Score = 40.0 bits (92), Expect = 0.001 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 8/52 (15%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGN-------ANTG-LCYKCNQPGHFARDC 268 C GH +RDC Y G+ A+ G LCYKCNQPGH A +C Sbjct: 121 CGSYGHQARDCTMGVKCYSCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNC 172 Score = 35.4 bits (80), Expect = 0.033 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 22/86 (25%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGL--------CYKCNQPGHFARDCPA-----Q 259 C + GH +R+C + Y + G+ + CY C GH RDCP+ Q Sbjct: 22 CGENGHQARECTKGSICYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDCPSSPNPRQ 81 Query: 258 G--------VGQ-ERQMYVNGAASGG 208 G VG R NG SGG Sbjct: 82 GAECYKCGRVGHIARDCRTNGQQSGG 107
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 44.3 bits (103), Expect = 7e-05 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 C Q GH SRDC N LCY CN+ GH ++DCP Sbjct: 121 CGQAGHMSRDCQ--------------NDRLCYNCNETGHISKDCP 151 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/44 (45%), Positives = 24/44 (54%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 CNQ GH SR+CP P +S + CYKC P H A+DC Sbjct: 70 CNQTGHISRECP---EPKKTSRFSKVS---CYKCGGPNHMAKDC 107 Score = 38.9 bits (89), Expect = 0.003 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSS--VGGNANTGLCYKCNQPGHFARDCP 265 CN+PGH DC Q G + V C+ CNQ GH +R+CP Sbjct: 28 CNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECP 81 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMY 232 C + GH + DC + LCY CN+PGH DC + +Q Y Sbjct: 9 CGKIGHLAEDCDSER--------------LCYNCNKPGHVQTDCTMPRTVEFKQCY 50
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 42.4 bits (98), Expect = 3e-04 Identities = 22/63 (34%), Positives = 28/63 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C QPGH S DCP V CY C QPGH +R+C + +E + G Sbjct: 163 CQQPGHRSSDCPEPRKEREPRV--------CYNCQQPGHTSRECTEERKPREGRTGGFGG 214 Query: 219 ASG 211 +G Sbjct: 215 GAG 217 Score = 35.4 bits (80), Expect = 0.033 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 11/75 (14%) Frame = -3 Query: 387 GHFSRDCPGQAAPYGSSVGGNANTGL-----------CYKCNQPGHFARDCPAQGVGQER 241 G F G + GS GGN+ G C+ C QPGH + DCP +E Sbjct: 123 GGFGGSATGFGSGGGSFGGGNSGFGEGGHGGGERNNNCFNCQQPGHRSSDCPEPRKEREP 182 Query: 240 QMYVNGAASGGYNRQ 196 ++ N G +R+ Sbjct: 183 RVCYNCQQPGHTSRE 197 Score = 33.1 bits (74), Expect = 0.16 Identities = 19/71 (26%), Positives = 24/71 (33%), Gaps = 26/71 (36%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGG----------NANTGL----------------CYKC 298 C QPGH SR+C + P GG N G C+ C Sbjct: 188 CQQPGHTSRECTEERKPREGRTGGFGGGAGFGNNGGNDGFGGDGGFGGGEERGPMKCFNC 247 Query: 297 NQPGHFARDCP 265 GH + +CP Sbjct: 248 KGEGHRSAECP 258 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 C GH S +CP P G C+ C + GH + +CP Sbjct: 247 CKGEGHRSAECP--EPPRG-----------CFNCGEQGHRSNECP 278
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 9/57 (15%) Frame = -3 Query: 402 KCNQPGHFSRDCP-GQAAPYGSSVGGNAN--------TGLCYKCNQPGHFARDCPAQ 259 KC + GH++R+CP G G G A +CY+C + GH A+DC Q Sbjct: 8 KCGRTGHWARECPTGIGRGRGMRSRGRAGFQFMSSSLPDICYRCGESGHLAKDCDLQ 64 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 12/57 (21%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQA--APYGSSVGGNA----------NTGLCYKCNQPGHFARDC 268 +C + GH ++DC Q A Y GG+ CY C +PGH ARDC Sbjct: 50 RCGESGHLAKDCDLQEDKACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC 106 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGAA 217 C+KC + GH+AR+CP G+G+ R M G A Sbjct: 6 CFKCGRTGHWARECPT-GIGRGRGMRSRGRA 35 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +RDC +A+ CY C + GH +DC Sbjct: 96 CGKPGHLARDCD------------HADEQKCYSCGEFGHIQKDC 127 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +DC G+ + + CY+C + GH AR+C Sbjct: 117 CGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 166
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 15/63 (23%) Frame = -3 Query: 402 KCNQPGHFSRDCP---------------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 KC + GH++R+CP G + G ++ +CY+C + GH A+DC Sbjct: 8 KCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC 67 Query: 267 PAQ 259 Q Sbjct: 68 DLQ 70 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 12/57 (21%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQA--APYGSSVGGNA----------NTGLCYKCNQPGHFARDC 268 +C + GH ++DC Q A Y GG+ CY C +PGH ARDC Sbjct: 56 RCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC 112 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +RDC +A+ CY C + GH +DC Sbjct: 102 CGKPGHLARDCD------------HADEQKCYSCGEFGHIQKDC 133 Score = 33.9 bits (76), Expect = 0.095 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 C+KC + GH+AR+CP G G+ R M G GG+ Sbjct: 6 CFKCGRSGHWARECPTGG-GRGRGMRSRG--RGGF 37 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +DC G+ + + CY+C + GH AR+C Sbjct: 123 CGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 172
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 11/56 (19%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQA-APYGSSVGGNA----------NTGLCYKCNQPGHFARDC 268 +C + GH ++DC Q A Y GG+ CY C +PGH ARDC Sbjct: 56 RCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC 111 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 15/63 (23%) Frame = -3 Query: 402 KCNQPGHFSRDCP---------------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 KC + GH++R+CP G + G ++ +CY+C + GH A+DC Sbjct: 8 KCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC 67 Query: 267 PAQ 259 Q Sbjct: 68 DLQ 70 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +RDC +A+ CY C + GH +DC Sbjct: 101 CGKPGHLARDCD------------HADEQKCYSCGEFGHIQKDC 132 Score = 33.9 bits (76), Expect = 0.095 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 C+KC + GH+AR+CP G G+ R M G GG+ Sbjct: 6 CFKCGRSGHWARECPTGG-GRGRGMRSRG--RGGF 37 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +DC G+ + + CY+C + GH AR+C Sbjct: 122 CGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 11/56 (19%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQA-APYGSSVGGNA----------NTGLCYKCNQPGHFARDC 268 +C + GH ++DC Q A Y GG+ CY C +PGH ARDC Sbjct: 56 RCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC 111 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 15/63 (23%) Frame = -3 Query: 402 KCNQPGHFSRDCP---------------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 KC + GH++R+CP G + G ++ +CY+C + GH A+DC Sbjct: 8 KCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC 67 Query: 267 PAQ 259 Q Sbjct: 68 DLQ 70 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +RDC +A+ CY C + GH +DC Sbjct: 101 CGKPGHLARDCD------------HADEQKCYSCGEFGHIQKDC 132 Score = 33.9 bits (76), Expect = 0.095 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 C+KC + GH+AR+CP G G+ R M G GG+ Sbjct: 6 CFKCGRSGHWARECPTGG-GRGRGMRSRG--RGGF 37 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +DC G+ + + CY+C + GH AR+C Sbjct: 122 CGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 11/56 (19%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQA-APYGSSVGGNA----------NTGLCYKCNQPGHFARDC 268 +C + GH ++DC Q A Y GG+ CY C +PGH ARDC Sbjct: 56 RCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC 111 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 15/63 (23%) Frame = -3 Query: 402 KCNQPGHFSRDCP---------------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 KC + GH++R+CP G + G ++ +CY+C + GH A+DC Sbjct: 8 KCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC 67 Query: 267 PAQ 259 Q Sbjct: 68 DLQ 70 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +RDC +A+ CY C + GH +DC Sbjct: 101 CGKPGHLARDCD------------HADEQKCYSCGEFGHIQKDC 132 Score = 33.9 bits (76), Expect = 0.095 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 C+KC + GH+AR+CP G G+ R M G GG+ Sbjct: 6 CFKCGRSGHWARECPTGG-GRGRGMRSRG--RGGF 37 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCP-------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +DC G+ + + CY+C + GH AR+C Sbjct: 122 CGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVN-CYRCGESGHLAREC 171
>GLH4_CAEEL (O76743) ATP-dependent RNA helicase glh-4 (EC 3.6.1.-) (Germline| helicase 4) Length = 1156 Score = 38.9 bits (89), Expect = 0.003 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 13/65 (20%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGS----SVGGN---------ANTGLCYKCNQPGHFARDCPAQ 259 C Q GHF+ DC P G + G+ G C C Q GHFA+DC + Sbjct: 598 CEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVPRGPCRNCGQEGHFAKDCQNE 657 Query: 258 GVGQE 244 V E Sbjct: 658 RVRME 662 Score = 33.9 bits (76), Expect = 0.095 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 C Q GHF++DC + T C +C + GH+ +CP + Sbjct: 644 CGQEGHFAKDCQNERVRMEP-------TEPCRRCAEEGHWGYECPTR 683 Score = 32.3 bits (72), Expect = 0.28 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH S++C P C C Q GHFA DC Sbjct: 575 CGEEGHISKECDKPKVPRFP----------CRNCEQLGHFASDC 608
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 38.9 bits (89), Expect = 0.003 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 309 CYKCNQPGHFARDCP 265 CY CNQPGHF RDCP Sbjct: 232 CYNCNQPGHFKRDCP 246 Score = 34.7 bits (78), Expect = 0.056 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVG 331 CNQPGHF RDCP G + G Sbjct: 235 CNQPGHFKRDCPNPRKGKGETSG 257
>GAG_BLVJ (P03344) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 +C + GH++RDCP +A G C C P H+ RDCP Sbjct: 348 RCLKEGHWARDCPTKAT--------GPPPGPCPICKDPSHWKRDCP 385 Score = 35.4 bits (80), Expect = 0.033 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 315 GLCYKCNQPGHFARDCPAQGVG 250 G CY+C + GH+ARDCP + G Sbjct: 344 GPCYRCLKEGHWARDCPTKATG 365
>GAG_HTLV2 (P03346) Gag polyprotein [Contains: Core protein p15 (p19); Core| protein p24; Core protein p12 (p15)] Length = 432 Score = 38.1 bits (87), Expect = 0.005 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQE 244 +C + GH+SRDC P G C C P H+ RDCP QE Sbjct: 364 RCGKVGHWSRDCTQPRPPPGP----------CPLCQDPSHWKRDCPQLKPPQE 406
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH S C AP +C+KC QPGHF++ C Sbjct: 386 CGKPGHLSSQC---RAPK-----------VCFKCKQPGHFSKQC 415 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 363 GQAAPY--GSSVGGNANTG-LCYKCNQPGHFARDCPAQGV 253 G A P+ G+ GG CY C +PGH + C A V Sbjct: 362 GLAGPFKGGALKGGPLKAAQTCYNCGKPGHLSSQCRAPKV 401 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 402 KCNQPGHFSRDC 367 KC QPGHFS+ C Sbjct: 404 KCKQPGHFSKQC 415
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH S C AP +C+KC QPGHF++ C Sbjct: 386 CGKPGHLSSQC---RAPK-----------VCFKCKQPGHFSKQC 415 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 363 GQAAPY--GSSVGGNANTG-LCYKCNQPGHFARDCPAQGV 253 G A P+ G+ GG CY C +PGH + C A V Sbjct: 362 GLAGPFKGGALKGGPLKAAQTCYNCGKPGHLSSQCRAPKV 401 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 402 KCNQPGHFSRDC 367 KC QPGHFS+ C Sbjct: 404 KCKQPGHFSKQC 415
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH S C AP +C+KC QPGHF++ C Sbjct: 386 CGKPGHLSSQC---RAPK-----------VCFKCKQPGHFSKQC 415 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 363 GQAAPY--GSSVGGNANTG-LCYKCNQPGHFARDCPAQGV 253 G A P+ G+ GG CY C +PGH + C A V Sbjct: 362 GLAGPFKGGALKGGPLKAAQTCYNCGKPGHLSSQCRAPKV 401 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 402 KCNQPGHFSRDC 367 KC QPGHFS+ C Sbjct: 404 KCKQPGHFSKQC 415
>GAG_RSVP (P03322) Gag polyprotein [Contains: Core protein p19; Core protein| p2A; Core protein p2B; Core protein p10; Capsid protein p27; Inner coat protein p12; Protease p15 (EC 3.4.23.-)] Length = 701 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 345 GSSVGGNANTGLCYKCNQPGHFARDCPAQ---GVGQERQMYVNG 223 G + G GLCY C PGH+ CP + G +ER NG Sbjct: 497 GQTGSGGRARGLCYTCGSPGHYQAQCPKKRKSGNSRERCQLCNG 540 Score = 33.1 bits (74), Expect = 0.16 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C PGH+ CP + GN+ C CN GH A+ C + G + Q G Sbjct: 512 CGSPGHYQAQCPKKRK------SGNSRE-RCQLCNGMGHNAKQCRKRD-GNQGQRPGKGL 563 Query: 219 ASG 211 +SG Sbjct: 564 SSG 566
>GAG_HTL1M (P14077) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 428 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 +C + GH+SRDC P G C C P H+ RDCP Sbjct: 358 RCGKAGHWSRDCTQPRPPPGP----------CPLCQDPTHWKRDCP 393 Score = 27.3 bits (59), Expect = 8.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 C++C + GH++RDC Sbjct: 356 CFRCGKAGHWSRDC 369
>GAG_HTL1C (P14076) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 +C + GH+SRDC P G C C P H+ RDCP Sbjct: 359 RCGKAGHWSRDCTQPRPPPGP----------CPLCQDPTHWKRDCP 394 Score = 27.3 bits (59), Expect = 8.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 C++C + GH++RDC Sbjct: 357 CFRCGKAGHWSRDC 370
>GAG_HTL1A (P03345) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 +C + GH+SRDC P G C C P H+ RDCP Sbjct: 359 RCGKAGHWSRDCTQPRPPPGP----------CPLCQDPTHWKRDCP 394 Score = 27.3 bits (59), Expect = 8.9 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 C++C + GH++RDC Sbjct: 357 CFRCGKAGHWSRDC 370
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 37.0 bits (84), Expect = 0.011 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP 265 +C + GH++RDCP + G C C P H+ RDCP Sbjct: 348 RCLKEGHWARDCPTKTT--------GPPPGPCPICKDPSHWKRDCP 385 Score = 34.7 bits (78), Expect = 0.056 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 315 GLCYKCNQPGHFARDCPAQGVG 250 G CY+C + GH+ARDCP + G Sbjct: 344 GPCYRCLKEGHWARDCPTKTTG 365
>POL_HV2CA (P24107) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 35.8 bits (81), Expect = 0.025 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 8/77 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ--------GVGQE 244 C + GH +R C AP C+KC +PGH +CP + +G+E Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMTNCPDRQAGFLRDWPLGKE 440 Query: 243 RQMYVNGAASGGYNRQS 193 + G +S G N S Sbjct: 441 APQFPRGPSSTGANTNS 457
>AIR2_YEAST (Q12476) Protein AIR2 (Arginine methyltransferase-interacting RING| finger protein 2) Length = 344 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGL-----CYKCNQPGHFARDCP 265 C+Q GH +DCP Y + + + C KC++ GH+ CP Sbjct: 66 CSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCP 115
>ZCHC9_HUMAN (Q8N567) Zinc finger CCHC domain-containing protein 9| Length = 271 Score = 35.4 bits (80), Expect = 0.033 Identities = 21/63 (33%), Positives = 27/63 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C + GH SR CP + G A+ G C C H +DCP + ER + V Sbjct: 189 CGEMGHLSRSCP------DNPKGLYADGGGCKLCGSVEHLKKDCP-ESQNSERMVTVGRW 241 Query: 219 ASG 211 A G Sbjct: 242 AKG 244 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 321 NTGLCYKCNQPGHFARDCPA 262 N +C+ C +PGH DCPA Sbjct: 126 NAMVCFHCRKPGHGIADCPA 145 Score = 30.0 bits (66), Expect = 1.4 Identities = 23/88 (26%), Positives = 31/88 (35%), Gaps = 29/88 (32%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCN------------------------- 295 C +PGH DCP AA +G TG+CY+C Sbjct: 133 CRKPGHGIADCP--AALENQDMG----TGICYRCGSTEHEITKCKAKVDPALGEFPFAKC 186 Query: 294 ----QPGHFARDCPAQGVGQERQMYVNG 223 + GH +R CP G +Y +G Sbjct: 187 FVCGEMGHLSRSCPDNPKG----LYADG 210
>GAG_SIVVG (P27978) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 521 Score = 35.0 bits (79), Expect = 0.043 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 C + GH R CP C KC +PGH A+DC Q Sbjct: 407 CGKFGHMQRQCP------------EPRKMRCLKCGKPGHLAKDCRGQ 441 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQ 358 KC +PGH ++DC GQ Sbjct: 427 KCGKPGHLAKDCRGQ 441
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 34.7 bits (78), Expect = 0.056 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 C + GH R CP C KC +PGH A+DC Q Sbjct: 403 CGKFGHMQRQCP------------EPRKIKCLKCGKPGHLAKDCRGQ 437 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQ 358 KC +PGH ++DC GQ Sbjct: 423 KCGKPGHLAKDCRGQ 437
>ZCHC9_MOUSE (Q8R1J3) Zinc finger CCHC domain-containing protein 9| Length = 273 Score = 34.7 bits (78), Expect = 0.056 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH SR CP ++ G A+ G C C HF +DC Sbjct: 189 CGEMGHLSRSCPD------NTKGVYADGGSCKLCGSVEHFKKDC 226 Score = 32.0 bits (71), Expect = 0.36 Identities = 22/84 (26%), Positives = 29/84 (34%), Gaps = 23/84 (27%) Frame = -3 Query: 399 CNQPGHFSRDCP----------------GQAAPYGSSVGGNANTGL-------CYKCNQP 289 C QPGH DCP G S N + L C+ C + Sbjct: 133 CRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMSKCRANVDPALGEFPFAKCFVCGEM 192 Query: 288 GHFARDCPAQGVGQERQMYVNGAA 217 GH +R CP G +Y +G + Sbjct: 193 GHLSRSCPDNTKG----VYADGGS 212 Score = 32.0 bits (71), Expect = 0.36 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 321 NTGLCYKCNQPGHFARDCPA 262 N +C+ C QPGH DCPA Sbjct: 126 NAMVCFHCRQPGHGIADCPA 145
>AIR1_YEAST (P40507) Protein AIR1 (Arginine methyltransferase-interacting RING| finger protein 1) Length = 360 Score = 34.3 bits (77), Expect = 0.073 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTG-----LCYKCNQPGHFARDCP 265 C+Q GH R+CP Y + + + +C CN GH+ CP Sbjct: 79 CSQRGHLKRNCPHVICTYCGFMDDHYSQHCPKAIICTNCNANGHYKSQCP 128 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 7/51 (13%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTG-------LCYKCNQPGHFARDC 268 CN H CP Y +AN G CY C GHF DC Sbjct: 139 CNSKRHSRERCPSIWRSYLLKTK-DANQGDFDFQTVFCYNCGNAGHFGDDC 188
>ZCHC5_HUMAN (Q8N8U3) Zinc finger CCHC domain-containing protein 5| Length = 475 Score = 34.3 bits (77), Expect = 0.073 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 312 LCYKCNQPGHFARDCPAQ 259 LC C PGHFARDCP + Sbjct: 444 LCLYCGYPGHFARDCPVK 461 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGN 325 C PGHF+RDCP P+ + GN Sbjct: 448 CGYPGHFARDCP--VKPHQALQAGN 470
>GAG_SRV2 (P51516) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 653 Score = 33.9 bits (76), Expect = 0.095 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 KC + GHF++DC + + + GLC +C + H+A +C ++ Sbjct: 547 KCGKKGHFAKDC----RDHSNKNPESKVPGLCPRCKRGKHWANECKSK 590 Score = 33.1 bits (74), Expect = 0.16 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 327 NANTGLCYKCNQPGHFARDC 268 N + G C+KC + GHFA+DC Sbjct: 539 NKDRGGCFKCGKKGHFAKDC 558
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 33.5 bits (75), Expect = 0.12 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -3 Query: 333 GGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 G TG CY+C Q GH++++CP G R+ G +S G+ Sbjct: 155 GMGERTG-CYRCGQEGHWSKECPLDQNGSYRE----GPSSEGF 192
>GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; Core protein| p18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 612 Score = 33.5 bits (75), Expect = 0.12 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C QPGH + CP + + +SV LC +C + H+ARDC Sbjct: 512 CGQPGHRAAVCPQK---HQTSVN---TPNLCPRCKKGKHWARDC 549 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 327 NANTGLCYKCNQPGHFARDCPAQGVGQERQMYVN 226 + N+G C+ C QPGH A CP Q+ Q VN Sbjct: 504 SGNSG-CFVCGQPGHRAAVCP-----QKHQTSVN 531
>ZCH13_HUMAN (Q8WW36) Zinc finger CCHC domain-containing protein 13| Length = 166 Score = 33.5 bits (75), Expect = 0.12 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = -3 Query: 399 CNQPGHFSRDCP--------GQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 C GH++R CP G GS G + CY C + G A++C G Sbjct: 9 CGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLG 64 Score = 33.1 bits (74), Expect = 0.16 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNG 223 C + GH ++DC CY C + GH ARDC Q +E++ Y G Sbjct: 70 CGRSGHIAKDCKDPKRERRQH---------CYTCGRLGHLARDCDRQ---KEQKCYSCG 116 Score = 32.7 bits (73), Expect = 0.21 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = -3 Query: 306 YKCNQPGHFARDCPAQGVGQERQMYVNGAASGGYNRQSYVGS*VVWPITCF 154 + C GH+AR CP G G G GG+ R S GS TC+ Sbjct: 7 FACGHSGHWARGCPRGGAG--------GRRGGGHGRGSQCGS-TTLSYTCY 48 Score = 32.3 bits (72), Expect = 0.28 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 6/57 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVG--GNANTGL----CYKCNQPGHFARDCPAQGVGQ 247 C + GH +RDC Q S G G+ CY+C + GH A +C GQ Sbjct: 94 CGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQ 150
>MSL5_YEAST (Q12186) Branchpoint-bridging protein MSL5 (MUD synthesis lethal 5| protein) Length = 476 Score = 33.5 bits (75), Expect = 0.12 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C H DCP + P N +C C Q GHF+RDC Sbjct: 276 CGLKDHKRYDCPNRKIP-------NIQGIVCKICGQTGHFSRDC 312
>GAG_BIV27 (P19559) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 33.5 bits (75), Expect = 0.12 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH R+C Q CY C +PGH AR+C Sbjct: 408 CGKTGHLKRNCKQQK---------------CYHCGKPGHQARNC 436 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -3 Query: 366 PGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 P Y S G + CY C + GH R+C Q Sbjct: 386 PHTPEAYASQTSGPEDGRRCYGCGKTGHLKRNCKQQ 421
>GAG_BIV06 (P19558) Gag polyprotein (p53) [Contains: Matrix protein p17;| Capsid protein p26; Nucleocapsid protein p14] Length = 476 Score = 33.5 bits (75), Expect = 0.12 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH R+C Q CY C +PGH AR+C Sbjct: 408 CGKTGHLKRNCKQQK---------------CYHCGKPGHQARNC 436 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -3 Query: 366 PGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 P Y S G + CY C + GH R+C Q Sbjct: 386 PHTPEAYASQTSGPEDGRRCYGCGKTGHLKRNCKQQ 421
>GAG_HV2BE (P18095) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 33.1 bits (74), Expect = 0.16 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC +PGH +CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMANCPERQAG 430
>POL_HV2RO (P04584) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 33.1 bits (74), Expect = 0.16 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 8/77 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ--------GVGQE 244 C + GH +R C AP C+KC +PGH +CP + +G+E Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMTNCPDRQAGFLRTGPLGKE 440 Query: 243 RQMYVNGAASGGYNRQS 193 G +S G + S Sbjct: 441 APQLPRGPSSAGADTNS 457
>POL_HV2BE (P18096) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1549 Score = 33.1 bits (74), Expect = 0.16 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC +PGH +CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMANCPERQAG 430
>GAG_SRV1 (P04022) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 657 Score = 33.1 bits (74), Expect = 0.16 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANT---GLCYKCNQPGHFARDCPAQ 259 KC + GHF+++C + N+ T GLC +C + H+A +C ++ Sbjct: 551 KCGRKGHFAKNCH-------EHIHNNSETKAPGLCPRCKRGKHWANECKSK 594 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 315 GLCYKCNQPGHFARDC 268 G C+KC + GHFA++C Sbjct: 547 GCCFKCGRKGHFAKNC 562
>GAG_HV2CA (P24106) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC +PGH +CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMTNCPDRQAG 430
>GAG_HV2RO (P04590) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 521 Score = 32.7 bits (73), Expect = 0.21 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC +PGH +CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKPGHIMTNCPDRQAG 430
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 32.3 bits (72), Expect = 0.28 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQG 256 C++C +PGH+ ++CP G Sbjct: 161 CFRCGKPGHYIKNCPTNG 178
>GAG_MMTVC (P11284) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 32.3 bits (72), Expect = 0.28 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 348 YGSSVGGNANTG-LCYKCNQPGHFARDC 268 YG GG + G +C+ C + GH RDC Sbjct: 512 YGGGKGGQGSKGPVCFSCGKTGHIKRDC 539 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 C + GH RDC + GS A GLC +C + H+ +C ++ Sbjct: 529 CGKTGHIKRDCKEEK---GSK---RAPPGLCPRCKKGYHWKSECKSK 569
>COAT_FMVD (P09519) Probable coat protein| Length = 489 Score = 32.3 bits (72), Expect = 0.28 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = -3 Query: 390 PG-HFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQER-QMYVNGAA 217 PG +FS+ P + P G C+ C + GH+A +CP + QE+ ++ ++G Sbjct: 389 PGKYFSKKKPEKFCPQGRK------KCRCWICTEEGHYANECPNRKSHQEKVKILIHGMN 442 Query: 216 SGGYN-RQSYVGS 181 G Y +Y G+ Sbjct: 443 EGYYPLEDAYTGN 455
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 32.3 bits (72), Expect = 0.28 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQG 256 C++C +PGH+ ++CP G Sbjct: 162 CFRCGKPGHYIKNCPTNG 179
>GAG_FIVWO (Q05313) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C + C KC +PGH A C Sbjct: 380 CKRPGHLARQC--------------RDVKKCNKCGKPGHLAAKC 409 Score = 28.5 bits (62), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 312 LCYKCNQPGHFARDC 268 +C+ C +PGH AR C Sbjct: 376 VCFNCKRPGHLARQC 390
>GAG_FIVSD (P19027) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 32.0 bits (71), Expect = 0.36 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C + C KC +PGH A C Sbjct: 380 CKKPGHLARQC--------------RDVKKCNKCGKPGHLAAKC 409 Score = 28.5 bits (62), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 312 LCYKCNQPGHFARDC 268 +C+ C +PGH AR C Sbjct: 376 VCFNCKKPGHLARQC 390
>GAK18_HUMAN (P62690) HERV-K_22q11.23 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 622 Score = 32.0 bits (71), Expect = 0.36 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 G ++GG T CY C Q GH R CP G +Q +N A Sbjct: 578 GLTLGGQVRTFGKKCYNCGQIGHLKRSCP----GLNKQNIINQA 617
>GAG_MPMV (P07567) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp24; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 656 Score = 32.0 bits (71), Expect = 0.36 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANT---GLCYKCNQPGHFARDCPAQ 259 KC + GHF+++C A NA GLC +C + H+A +C ++ Sbjct: 550 KCGKKGHFAKNCHEHAH-------NNAEPKVPGLCPRCKRGKHWANECKSK 593 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 315 GLCYKCNQPGHFARDC 268 G C+KC + GHFA++C Sbjct: 546 GCCFKCGKKGHFAKNC 561
>TENX_HUMAN (P22105) Tenascin-X precursor (TN-X) (Hexabrachion-like protein)| Length = 4289 Score = 31.6 bits (70), Expect = 0.47 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 PG+ DC ++ P G S G G C CN PG+ DC Sbjct: 268 PGYTGDDCGMRSCPRGCSQRGRCENGRCV-CN-PGYTGEDC 306 Score = 31.2 bits (69), Expect = 0.62 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 CN PG+ DC ++ P G S G G C C+ PG+ DC Sbjct: 297 CN-PGYTGEDCGVRSCPRGCSQRGRCKDGRCV-CD-PGYTGEDC 337 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 PG+ DC ++ P+ GG G C C PG+ DC Sbjct: 330 PGYTGEDCGTRSCPWDCGEGGRCVDGRCV-C-WPGYTGEDC 368 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 PG+ RDC +A P G G C CN PG DC Sbjct: 485 PGYTGRDCGTRACPGDCRGRGRCVDGRCV-CN-PGFTGEDC 523 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 PG+ DC +A P G G+C CN G+ DC Sbjct: 423 PGYTGTDCGSRACPRDCRGRGRCENGVCV-CN-AGYSGEDC 461
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 C + GH R CP C KC + GH A+DC Q Sbjct: 402 CGKFGHMQRQCP------------EPRKTKCLKCGKLGHLAKDCRGQ 436
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 31.6 bits (70), Expect = 0.47 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGHF +DC AP GG LC KC + H A C Sbjct: 463 CGKPGHFKKDC---RAP--DKQGGTLT--LCSKCGKGYHRADQC 499 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 309 CYKCNQPGHFARDCPA 262 C+ C +PGHF +DC A Sbjct: 460 CFNCGKPGHFKKDCRA 475
>GAK5_HUMAN (P62684) HERV-K_19p13.11 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K113 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK4_HUMAN (P63126) HERV-K_6q14.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K109 Gag protein) (HERV-K(C6) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK3_HUMAN (Q9YNA8) HERV-K_19q12 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(C19) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK1_HUMAN (P62683) HERV-K_12q14.1 provirus ancestral Gag polyprotein (Gag| polyprotein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK12_HUMAN (P63130) HERV-K_1q22 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K102 Gag protein) (HERV-K(III) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK11_HUMAN (P63145) HERV-K_22q11.21 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K101 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAK10_HUMAN (P87889) HERV-K_5q33.3 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K10 Gag protein) (HERV-K107 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>GAG_CAEVC (P33458) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 441 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 330 GNANTGLCYKCNQPGHFARDCPAQGV 253 GN CY C +PGH AR C QG+ Sbjct: 374 GNGQPQRCYNCGKPGHQARQC-RQGI 398
>YL92_SCHPO (Q9HFF2) Hypothetical protein C683.02c in chromosome I| Length = 218 Score = 31.6 bits (70), Expect = 0.47 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 3/66 (4%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYV--- 229 C Q GH +DCP N +C++C H C +G + + ++ Sbjct: 82 CRQQGHIVQDCP----------EAKDNVSICFRCGSKEHSLNACSKKGPLKFAKCFICHE 131 Query: 228 NGAASG 211 NG SG Sbjct: 132 NGHLSG 137 Score = 28.1 bits (61), Expect = 5.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 309 CYKCNQPGHFARDCP 265 C+ C Q GH +DCP Sbjct: 79 CFACRQQGHIVQDCP 93 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C++ GH S C + P G G G C C+ H A+DC Sbjct: 129 CHENGHLSGQC--EQNPKGLYPKG----GCCKFCSSVHHLAKDC 166
>LARK_DROME (Q94901) RNA-binding protein lark| Length = 352 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = -3 Query: 309 CYKCNQPGHFARDCP----AQGVGQERQMYVNGAASGGYNRQSY 190 CY+C + GH++++CP + G G+E + ++GGY + Y Sbjct: 170 CYRCGRSGHWSKECPRLYGSAGGGREPP---SPLSAGGYRDRMY 210 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGG 328 +C + GH+S++CP YGS+ GG Sbjct: 172 RCGRSGHWSKECP---RLYGSAGGG 193
>GAG_FIVPE (P16087) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C C KC +PGH A C Sbjct: 380 CKKPGHLARQC--------------REVKKCNKCGKPGHLAAKC 409 Score = 28.5 bits (62), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 312 LCYKCNQPGHFARDC 268 +C+ C +PGH AR C Sbjct: 376 VCFNCKKPGHLARQC 390
>GAG_SIVMS (P31634) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 510 Score = 31.6 bits (70), Expect = 0.47 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH ++ C AP C+KC +PGH CP + VG Sbjct: 396 CGKEGHTAKQCK---APRRQG---------CWKCGKPGHQMAKCPERQVG 433
>GAK6_HUMAN (P62685) HERV-K_8p23.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K115 Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 646 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T G CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGGKCYNCGQIGHLKKNCP 559 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594
>TIE1_HUMAN (P35590) Tyrosine-protein kinase receptor Tie-1 precursor (EC| 2.7.10.1) Length = 1138 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 351 PYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 PYG S G C + PGHF DC Q Sbjct: 288 PYGCSCGSGWRGSQCQEACAPGHFGADCRLQ 318
>RBM4_RABIT (Q9BDY9) RNA-binding protein 4 (RNA-binding motif protein 4) (Lark| homolog) Length = 359 Score = 30.8 bits (68), Expect = 0.80 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPVDRTGR 182
>RBM4B_HUMAN (Q9BQ04) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 359 Score = 30.8 bits (68), Expect = 0.80 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPVDRTGR 182
>GAK8_HUMAN (Q9HDB9) HERV-K_3q12.3 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(II) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 666 Score = 30.8 bits (68), Expect = 0.80 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -3 Query: 399 CNQPGHFSRDCP----GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH R CP + +GLC KC + H+A C Sbjct: 547 CGQIGHLKRSCPVLNKQNIINQAITAKNKKPSGLCPKCGKGKHWANQC 594 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G ++GG T CY C Q GH R CP Sbjct: 530 GLTLGGQVRTFGKKCYNCGQIGHLKRSCP 558
>RBM4B_RAT (Q64LC9) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 30.8 bits (68), Expect = 0.80 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPVDRTGR 182
>RBM4B_MOUSE (Q8VE92) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 357 Score = 30.8 bits (68), Expect = 0.80 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPVDRTGR 182
>GAG_FIVT2 (P31821) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 449 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C C C +PGH A +C Sbjct: 380 CKKPGHLARQCK--------------EAKRCNNCGKPGHLAANC 409 Score = 28.5 bits (62), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 312 LCYKCNQPGHFARDC 268 +C+ C +PGH AR C Sbjct: 376 VCFNCKKPGHLARQC 390
>GAK2_HUMAN (Q7LDI9) HERV-K_7p22.1 provirus ancestral Gag polyprotein (Gag| polyprotein) (HERV-K(HML-2.HOM) Gag protein) (HERV-K108 Gag protein) (HERV-K(C7) Gag protein) [Contains: Matrix protein; Capsid protein; Nucleocapsid protein] Length = 665 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 399 CNQPGHFSRDCP---GQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C Q GH ++CP Q ++ G LC +C + H+A C Sbjct: 548 CGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQC 594 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 345 GSSVGGNANT--GLCYKCNQPGHFARDCP 265 G +GG T CY C Q GH ++CP Sbjct: 531 GVVLGGQVRTFGRKCYNCGQIGHLKKNCP 559
>GAG_SIVCZ (P17282) Gag polyprotein [Contains: Core protein p18; Core protein| p25; Core protein p16] Length = 508 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGV 253 C + GH +R+C AP C++C Q GH +DC + V Sbjct: 405 CGKEGHLARNCK---APRRKG---------CWRCGQEGHQMKDCTGRQV 441
>POL_HV2SB (P12451) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 30.0 bits (66), Expect = 1.4 Identities = 21/77 (27%), Positives = 28/77 (36%), Gaps = 8/77 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCP--------AQGVGQE 244 C + GH +R C AP C+KC + GH +CP A +G+E Sbjct: 392 CGKEGHSARQC---RAPRRQG---------CWKCGKSGHIMANCPDRQAGFLRAWTMGKE 439 Query: 243 RQMYVNGAASGGYNRQS 193 G G N S Sbjct: 440 APQLPRGPKFAGANTNS 456
>ZCHC2_HUMAN (Q9C0B9) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 899 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -3 Query: 393 QPGHFSRDCPGQAAPY------GSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQ 238 Q F R P AP GS N N CY C GH+A+DC + +Q Sbjct: 821 QMAGFGRFYPVYPAPNVVANTSGSGPKKNGNVS-CYNCGVSGHYAQDCKQSSMEANQQ 877
>POL_HV2G1 (P18042) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/77 (25%), Positives = 29/77 (37%), Gaps = 8/77 (10%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQ--------GVGQE 244 C + GH +R C AP C+KC + GH CP + +G+E Sbjct: 394 CGKEGHSARQC---RAPRRQG---------CWKCGKTGHVMAKCPERQAGFLRDGSMGKE 441 Query: 243 RQMYVNGAASGGYNRQS 193 G +S G + S Sbjct: 442 APQLPRGPSSSGADTNS 458
>GAG_VILVK (P35955) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGV 253 CY C +PGH AR C QG+ Sbjct: 387 CYNCGKPGHLARQC-RQGI 404 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C +C+ C + GH +DC Sbjct: 390 CGKPGHLARQCRQGI--------------ICHHCGKRGHMQKDC 419
>GAG_VILV2 (P23425) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGV 253 CY C +PGH AR C QG+ Sbjct: 387 CYNCGKPGHLARQC-RQGI 404 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C +C+ C + GH +DC Sbjct: 390 CGKPGHLARQCRQGI--------------ICHHCGKRGHMQKDC 419
>GAG_VILV1 (P23424) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGV 253 CY C +PGH AR C QG+ Sbjct: 387 CYNCGKPGHLARQC-RQGI 404 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C +C+ C + GH +DC Sbjct: 390 CGKPGHLARQCRQGI--------------ICHHCGKRGHMQKDC 419
>GAG_VILV (P03352) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 442 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGV 253 CY C +PGH AR C QG+ Sbjct: 387 CYNCGKPGHLARQC-RQGI 404 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C +C+ C + GH +DC Sbjct: 390 CGKPGHLARQCRQGI--------------ICHHCGKRGHMQKDC 419
>TIE1_MOUSE (Q06806) Tyrosine-protein kinase receptor Tie-1 precursor (EC| 2.7.10.1) Length = 1134 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 10/47 (21%) Frame = -3 Query: 369 CPGQAA----------PYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 CPG A PYG S G C + P HF DC Q Sbjct: 270 CPGTAGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPDHFGADCRLQ 316
>RBM4_BOVIN (Q3MHX3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) Length = 362 Score = 30.0 bits (66), Expect = 1.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPVDRSGR 182
>GAG_MMTVB (P10258) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 348 YGSSVGGNANTG-LCYKCNQPGHFARDC 268 YG GG G +C+ C + GH +DC Sbjct: 512 YGGGKGGQGAEGPVCFSCGKTGHIRKDC 539
>POL_HV2KR (Q74120) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 30.0 bits (66), Expect = 1.4 Identities = 18/62 (29%), Positives = 25/62 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C + GH +R C AP C+KC + GH +CP + G R + Sbjct: 393 CGKDGHSARQC---RAPRRQG---------CWKCGKSGHVMANCPERQAGFLRDWPMGKE 440 Query: 219 AS 214 AS Sbjct: 441 AS 442
>GAG_HV2SB (P12450) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 519 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH +CP + G Sbjct: 392 CGKEGHSARQC---RAPRRQG---------CWKCGKSGHIMANCPDRQAG 429
>RBM4_MOUSE (Q8C7Q4) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (mLark) Length = 361 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPIDRSGR 182
>GAG_OMVVS (P16900) Gag polyprotein [Contains: Core protein p16; Core protein| p25; Core protein p14] Length = 446 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 330 GNANTGLCYKCNQPGHFARDCPAQGV 253 G CY C +PGH AR C QG+ Sbjct: 379 GKQGVQKCYYCGKPGHLARQC-RQGI 403 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C +PGH +R C +C+ C + GH +DC Sbjct: 389 CGKPGHLARQCRQGI--------------ICHHCGKRGHMQKDC 418
>ZCHC2_MOUSE (Q69ZB8) Zinc finger CCHC domain-containing protein 2 (Fragment)| Length = 1168 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 345 GSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQ 238 GS N N CY C GH+A+DC + +Q Sbjct: 1112 GSGPKKNGNVS-CYNCGVSGHYAQDCKQSSMEANQQ 1146
>RBM4_HUMAN (Q9BWF3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (hLark) Length = 364 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQ 247 CY+C + GH++++CP G+ Sbjct: 162 CYRCGKEGHWSKECPIDRSGR 182
>GAG_HV2KR (Q74119) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH +CP + G Sbjct: 393 CGKDGHSARQC---RAPRRQG---------CWKCGKSGHVMANCPERQAG 430
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH R+C AP C+KC + GH A+DC Sbjct: 395 CGKFGHMQRECK---APRQIK---------CFKCGKIGHMAKDC 426
>UNC52_CAEEL (Q06561) Basement membrane proteoglycan precursor (Perlecan homolog)| (Uncoordinated protein 52) Length = 3375 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGH 283 PG+ C AP S GG GLC KC GH Sbjct: 926 PGYVGTSCE-DCAPGYSRTGGGLYLGLCEKCECNGH 960
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 321 NTGLCYKCNQPGHFARDCPAQGVG 250 NT +C KC GH A DC Q G Sbjct: 275 NTTVCTKCGGAGHIASDCKFQRPG 298
>GAG_HV1RH (P05890) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 500 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 C + GH +++C AP C+KC + GH +DC +G Sbjct: 394 CGKVGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDCTNEG 429
>S12A3_RAT (P55018) Solute carrier family 12 member 3 (Thiazide-sensitive| sodium-chloride cotransporter) (Na-Cl symporter) Length = 1002 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 180 SYQHRIACCILLMRRHSHTSGAPGQHPAPDSLSQSDQADYICSTDQ 317 ++ CI+ MR + S A H AP++L Q +Q I ++Q Sbjct: 762 AFDFNYGVCIMRMREGLNVSEALQTHTAPEALVQEEQTSTIFQSEQ 807
>ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7| Length = 542 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMY 232 CY C Q GH+ +CP ER++Y Sbjct: 349 CYHCAQKGHYGHECP------EREVY 368 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPA 262 C++ GH S++CP C+ C++ GH CPA Sbjct: 245 CDKRGHLSKNCPLPR-----------KVRRCFLCSRRGHLLYSCPA 279
>GAG_HV2ST (P20874) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKAGHIMAKCPERQAG 430
>GAG_HV2D2 (P15832) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 392 CGKQGHTARQC---RAPRRQG---------CWKCGKTGHIMSKCPERQAG 429
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 29.3 bits (64), Expect = 2.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 321 NTGLCYKCNQPGHFARDCPAQGVG 250 NT +C KC GH A DC Q G Sbjct: 275 NTTVCTKCGGAGHIASDCKFQRPG 298
>POL_HV1RH (P05959) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1435 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 C + GH +++C AP C+KC + GH +DC +G Sbjct: 394 CGKVGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDCTNEG 429
>CDA_MUCRO (P50325) Chitin deacetylase precursor (EC 3.5.1.41)| Length = 421 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 185 PT*DCLLYPPDAAPFTYIWRSWPT 256 PT +C Y PDA+ FT+ WP+ Sbjct: 53 PTQECAYYTPDASLFTFNASEWPS 76
>POL_HV2ST (P20876) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 393 CGKEGHSARQC---RAPRRQG---------CWKCGKAGHIMAKCPERQAG 430
>POL_HV2D2 (P15833) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1464 Score = 29.3 bits (64), Expect = 2.3 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 392 CGKQGHTARQC---RAPRRQG---------CWKCGKTGHIMSKCPERQAG 429
>POL_HV1MA (P04588) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1439 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 400 CGKEGHLARNC---RAPRKKG---------CWKCGKEGHQMKDC 431
>POL_HV1BR (P03367) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1B5 (P04587) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNCK---APRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1J3 (P12498) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR)] (Fragment) Length = 531 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHLARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_IPHA (P04023) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 572 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 324 ANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGYNRQSYVG 184 +N C+ C + GH +DC A +E ++ GY+R S G Sbjct: 444 SNRKACFNCGRMGHLKKDCQAPERTRESKLCYR--CGKGYHRASECG 488
>POL_HV2D1 (P17757) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH ++ C AP C+KC + GH +CP + G Sbjct: 393 CGKEGHSAKQC---RAPRRQG---------CWKCGKSGHIMANCPERQAG 430
>POL_HV1C4 (P05960) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR)] (Fragment) Length = 549 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNCK---APRKKG---------CWKCGREGHQMKDC 425
>GAG_HV2G1 (P18041) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 521 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 394 CGKEGHSARQC---RAPRRQG---------CWKCGKTGHVMAKCPERQAG 431
>GAG_HV2D1 (P17756) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH ++ C AP C+KC + GH +CP + G Sbjct: 393 CGKEGHSAKQC---RAPRRQG---------CWKCGKSGHIMANCPERQAG 430
>GAG_HV1LW (Q70622) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1J3 (P12494) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHLARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1C4 (P05887) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNCK---APRKKG---------CWKCGREGHQMKDC 425
>GAG_HV1BR (P03348) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1B5 (P04593) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHIARNCK---APRKKG---------CWKCGKEGHQMKDC 425
>GAG_SIVSP (P19504) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH +R C AP C+KC + GH CP + G Sbjct: 397 CGKEGHSARQC---RAPRRQG---------CWKCGKAGHVMAKCPERQAG 434
>GAG_HV1MA (P04594) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 504 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 400 CGKEGHLARNC---RAPRKKG---------CWKCGKEGHQMKDC 431
>TIE1_BOVIN (Q06805) Tyrosine-protein kinase receptor Tie-1 precursor (EC| 2.7.10.1) Length = 1136 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 10/47 (21%) Frame = -3 Query: 369 CPGQAA----------PYGSSVGGNANTGLCYKCNQPGHFARDCPAQ 259 CPG + PYG S G C + PG F DC Q Sbjct: 270 CPGTSGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGRFGADCHLQ 316
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+ARDCP + G Sbjct: 504 CAYCKEKGHWARDCPKKPRG 523
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+ARDCP + G Sbjct: 503 CAYCKEKGHWARDCPKKPRG 522
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+ARDCP + G Sbjct: 503 CAYCKEKGHWARDCPKKPRG 522
>TNR1A_MOUSE (P25118) Tumor necrosis factor receptor superfamily member 1A| precursor (p60) (TNF-R1) (TNF-RI) (TNFR-I) (p55) Length = 454 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 390 PGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 P R+ P G V N+ C KC++ + DCP+ G Sbjct: 32 PSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPG 76
>SFRS7_MOUSE (Q8BL97) Splicing factor, arginine/serine-rich 7| Length = 267 Score = 28.1 bits (61), Expect = 5.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 CY+C + GH+A DC Sbjct: 135 CYECGEKGHYAYDC 148
>POL_HV1PV (P03368) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1B1 (P03366) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1446 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1H2 (P04585) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1PV (P03350) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1B1 (P03347) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 511 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1H2 (P04591) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH +DC Sbjct: 394 CGKEGHTARNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>SFRS7_HUMAN (Q16629) Splicing factor, arginine/serine-rich 7 (Splicing factor| 9G8) Length = 238 Score = 28.1 bits (61), Expect = 5.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 CY+C + GH+A DC Sbjct: 106 CYECGEKGHYAYDC 119
>NMDE2_RAT (Q00960) Glutamate [NMDA] receptor subunit epsilon 2 precursor| (N-methyl D-aspartate receptor subtype 2B) (NR2B) (NMDAR2B) Length = 1482 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 387 GHFSRDCPGQAAPYGSSVGG-NANTGLCYKC 298 G+F R CP + Y S+V G N+ C +C Sbjct: 1212 GNFCRSCPSKLHNYSSTVAGQNSGRQACIRC 1242
>NMDE2_MOUSE (Q01097) Glutamate [NMDA] receptor subunit epsilon 2 precursor| (N-methyl D-aspartate receptor subtype 2B) (NR2B) (NMDAR2B) Length = 1482 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 387 GHFSRDCPGQAAPYGSSVGG-NANTGLCYKC 298 G+F R CP + Y S+V G N+ C +C Sbjct: 1212 GNFCRSCPSKLHNYSSTVAGQNSGRQACIRC 1242
>YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III| Length = 2186 Score = 28.1 bits (61), Expect = 5.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 309 CYKCNQPGHFARDCP 265 C++CN+ GH A +CP Sbjct: 591 CFRCNEMGHIAWNCP 605
>POL_HV1U4 (P24740) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1427 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 388 CGKEGHLAKNC---RAPRKKG---------CWKCGKEGHQMKDC 419
>NIBL_MOUSE (Q8R1F1) Niban-like protein| Length = 749 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 398 VTSLGTFLETVQDRLPPTVLQLAATPTLVCAT 303 +TS+ +LE V + LP T + +TP L C T Sbjct: 125 LTSVDQYLELVGNSLPGTTSKSGSTPILKCPT 156
>POL_RTBVP (P27502) Polyprotein (P194 protein) [Contains: Coat protein;| Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1675 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNG 223 CY C H A CP + Q R ++G Sbjct: 774 CYICQDENHLANRCPRRYTNQARASLIDG 802
>YK61_CAEEL (P34340) Putative cuticle collagen C29E4.1| Length = 305 Score = 27.7 bits (60), Expect = 6.8 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 7/75 (9%) Frame = -3 Query: 402 KCNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARD-----CPAQGVGQERQ 238 K +PG + P A S G +A G K +PG +D CPA+ + Sbjct: 227 KHGEPGQDGEEGPKGAPGTPGSNGRDAYPGQPGKAGEPGAVGKDANYCPCPARRDSKTES 286 Query: 237 MYVNGAAS--GGYNR 199 ++ AAS GGY + Sbjct: 287 VHEPPAASQNGGYRK 301
>GAG_HV1Z2 (P12495) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 500 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 396 CGKEGHIAKNC---RAPRRKG---------CWKCGKEGHQLKDC 427
>FUS_BOVIN (Q28009) RNA-binding protein FUS (Pigpen protein)| Length = 512 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -3 Query: 363 GQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAASGGY 205 GQ + Y SS GG G G + +D P+ G Y N SGGY Sbjct: 156 GQQSQYNSSGGGGGGGG--------GSYGQDQPSMSSGGGGGGYGNQDQSGGY 200
>POL_HV1Y2 (P35963) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 394 CGKEGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1N5 (P12497) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 394 CGKEGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POLG_HCVJK (Q68801) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 340 FSWRQRQHWSV 308 FSWR RQHW+V Sbjct: 290 FSWRHRQHWTV 300
>GAG_HV1U4 (P24736) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 492 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 388 CGKEGHLAKNC---RAPRKKG---------CWKCGKEGHQMKDC 419
>GAG_HV1OY (P20889) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 498 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 393 CGKEGHIAKNC---RAPRKKG---------CWKCGREGHQMKDC 424
>POL_HV1OY (P20892) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1433 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 393 CGKEGHIAKNC---RAPRKKG---------CWKCGREGHQMKDC 424
>GAG_SIVS4 (P12496) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVG 250 C + GH ++ C AP C+KC + GH CP + G Sbjct: 397 CGKEGHSAKQC---RAPRRQG---------CWKCGKTGHVMAKCPERQAG 434
>GAG_HV1Y2 (P35962) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 394 CGKEGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>GAG_HV1N5 (P12493) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 394 CGKEGHIAKNC---RAPRKKG---------CWKCGKEGHQMKDC 425
>POL_HV1Z2 (P12499) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1435 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 396 CGKEGHIAKNC---RAPRRKG---------CWKCGKEGHQLKDC 427
>POL_COYMV (P19199) Putative polyprotein [Contains: Coat protein; Protease (EC| 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1886 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQER 241 CY C Q GH+A C + Q+R Sbjct: 881 CYICGQEGHYANQCRNKHKDQQR 903
>CPSF4_MOUSE (Q8BQZ5) Cleavage and polyadenylation specificity factor, 30 kDa| subunit (CPSF 30 kDa subunit) (Clipper homolog) (Clipper/CPSF 30K) Length = 211 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 CYKC + GH+A C Sbjct: 187 CYKCGEKGHYANRC 200
>ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 956 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 345 GSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQ 238 GSS + N CY C GH A+DC + RQ Sbjct: 904 GSSHKKSGNLS-CYNCGATGHRAQDCKQPSMDFNRQ 938
>GAG_MLVDE (P29168) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 501 CAYCKEKGHWAKDCPKKPRG 520
>GAG_MLVCB (P27460) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 501 CAYCKEKGHWAKDCPKKPRG 520
>NOC3_SCHPO (O94288) Nucleolar complex-associated protein 3| Length = 747 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 111 KYMKILQAVLK*TTENK*SAKLLSYQHRIACCILLMRRHSH 233 K+++ L+ +LK + +L YQ + CC L+ + SH Sbjct: 309 KFLQTLETILKSFSSTLDETQLSLYQVAVRCCTKLIEQASH 349
>NO40_MOUSE (Q9ESX4) Nucleolar protein of 40 kDa (pNO40) (Zinc finger CCHC| domain-containing protein 7) (Putative S1 RNA-binding domain protein) (PS1D protein) Length = 241 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C KC GHFA+DC Q G Sbjct: 133 CKKCGCKGHFAKDCFMQPGG 152
>NO40_HUMAN (Q9NP64) Nucleolar protein of 40 kDa (pNO40) (Zinc finger CCHC| domain-containing protein 7) (Putative S1 RNA binding domain protein) (PS1D protein) (Pnn-interacting nucleolar protein) Length = 241 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C KC GHFA+DC Q G Sbjct: 133 CKKCGCKGHFAKDCFMQPGG 152
>GAG_MLVDU (P23090) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 528 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 494 CAYCKEKGHWAKDCPKKPRG 513
>CPSF4_HUMAN (O95639) Cleavage and polyadenylation specificity factor, 30 kDa| subunit (CPSF 30 kDa subunit) (NS1 effector domain-binding protein 1) (Neb-1) (No arches homolog) Length = 269 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 309 CYKCNQPGHFARDC 268 CYKC + GH+A C Sbjct: 245 CYKCGEKGHYANRC 258
>COAT_SOCMV (P15627) Coat protein| Length = 441 Score = 27.3 bits (59), Expect = 8.9 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -3 Query: 309 CYKCNQPGHFARDCP 265 C+ C++ GH+A +CP Sbjct: 383 CWLCHEEGHYANECP 397
>COAT_CERV (P05399) Probable coat protein| Length = 494 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 309 CYKCNQPGHFARDCP 265 C+ CN GH+A +CP Sbjct: 420 CWVCNIEGHYANECP 434
>ZCHC6_HUMAN (Q5VYS8) Zinc finger CCHC domain-containing protein 6| Length = 1495 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 330 GNANTGLCYKCNQPGHFARDCP 265 G + T +C C + GH +DCP Sbjct: 958 GKSPTVVCSLCKREGHLKKDCP 979
>NO40_MACFA (Q95KF9) Nucleolar protein of 40 kDa (pNO40) (Zinc finger CCHC| domain-containing protein 2) (Putative S1 RNA binding domain protein) (PS1D protein) Length = 193 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C KC GHFA+DC Q G Sbjct: 85 CKKCGCKGHFAKDCFMQPGG 104
>GAG_MLVRD (P11269) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 502 CAYCKEKGHWAKDCPKKPRG 521
>GAG_MLVBM (P29167) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 502 CAYCKEKGHWAKDCPKKPRG 521
>GAG_MLVAV (P03336) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 502 CAYCKEKGHWAKDCPKKPRG 521
>ZCHC6_MOUSE (Q5BLK4) Zinc finger CCHC domain-containing protein 6| Length = 1491 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 330 GNANTGLCYKCNQPGHFARDCP 265 G + T +C C + GH +DCP Sbjct: 954 GKSPTVVCSLCKREGHLKKDCP 975
>YELL_DROYA (Q9BI17) Protein yellow precursor| Length = 541 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 327 NANTGLCYKCNQPGHFARDCPAQGVGQE--RQMYVNGAASGGYNRQ 196 N + G+ Y+ + P F PAQ GQ+ + YVN SG ++ Q Sbjct: 493 NQHNGINYETSGPHLFPTLQPAQPAGQDGGLKTYVNARQSGWWHHQ 538
>YELL_DROME (P09957) Protein yellow precursor| Length = 541 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 327 NANTGLCYKCNQPGHFARDCPAQGVGQE--RQMYVNGAASGGYNRQ 196 N + G+ Y+ + P F PAQ GQ+ + YVN SG ++ Q Sbjct: 493 NQHNGINYETSGPHLFPTHQPAQPGGQDGGLKTYVNARQSGWWHHQ 538
>ZCH11_HUMAN (Q5TAX3) Zinc finger CCHC domain-containing protein 11| Length = 1644 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVGQERQMYVNGA 220 C+ C GH R+CP + ++R V A Sbjct: 1359 CFICGDAGHVRRECPEVKLARQRNSSVAAA 1388
>POL_HV1JR (P20875) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1438 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH ++C Sbjct: 394 CGKEGHIARNC---RAPRKKG---------CWKCGKEGHQMKEC 425
>GAG_MLVHO (P21435) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 539 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 505 CAYCKEKGHWAKDCPKKPRG 524
>PO121_MOUSE (Q8K3Z9) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) Length = 1200 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = -3 Query: 366 PGQAAPYGSSVGGNANTGLCYKCNQPGHFARDCPAQGVGQERQMYVNGAAS 214 P Q +P+ SVG + + F + PA GVG GA+S Sbjct: 1106 PSQGSPFAFSVGSTPESKPVFGGTSTPTFGQSAPAPGVGTTGSSLSFGASS 1156
>GAG_HV1JR (P20873) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 503 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +R+C AP C+KC + GH ++C Sbjct: 394 CGKEGHIARNC---RAPRKKG---------CWKCGKEGHQMKEC 425
>RECQ4_MOUSE (Q75NR7) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) (RecQ| protein-like 4) Length = 1216 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 354 APYGSSVGGNANTGLCYKCNQPGHFARDCPAQG 256 A +G S + C++C Q GH+A C G Sbjct: 380 AAFGGSGPRATDKDTCFRCGQFGHWASQCSQPG 412
>POL_HV1MN (P05961) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1440 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 397 CGKEGHIAKNC---RAPRKRG---------CWKCGKEGHQMKDC 428
>GAG_MSVMO (P03334) Gag polyprotein R65 [Contains: Core protein p15; Inner| coat protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 503 CTYCEEQGHWAKDCPRRPRG 522
>GAG_MLVMO (P03332) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 309 CYKCNQPGHFARDCPAQGVG 250 C C + GH+A+DCP + G Sbjct: 503 CAYCKEKGHWAKDCPKKPRG 522
>GAG_HV1MN (P05888) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 506 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 399 CNQPGHFSRDCPGQAAPYGSSVGGNANTGLCYKCNQPGHFARDC 268 C + GH +++C AP C+KC + GH +DC Sbjct: 397 CGKEGHIAKNC---RAPRKRG---------CWKCGKEGHQMKDC 428
>CRBA2_BOVIN (P26444) Beta crystallin A2 (Beta-A2-crystallin)| Length = 196 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 237 SGAPGQHPAPDSLSQSDQADYICSTDQCWRCRQLKN 344 S AP Q PAP SL+ D+ D+ Q RCR L + Sbjct: 1 SSAPAQGPAPASLTLWDEEDF-----QGRRCRLLSD 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,463,588 Number of Sequences: 219361 Number of extensions: 1188678 Number of successful extensions: 3845 Number of sequences better than 10.0: 187 Number of HSP's better than 10.0 without gapping: 3321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3735 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
