Clone Name | rbastl01d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PFA3_GIBZE (Q4IA62) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Prot... | 32 | 0.98 | 2 | YSR4_CAEEL (Q09952) Hypothetical protein F59B10.4 | 31 | 2.2 | 3 | PQQD_SILPO (Q5LTB3) Coenzyme PQQ synthesis protein D (Pyrroloqui... | 31 | 2.2 |
---|
>PFA3_GIBZE (Q4IA62) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Protein fatty| acyltransferase 3) Length = 550 Score = 32.0 bits (71), Expect = 0.98 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 265 LFCILLYAVLVCWRWYEQSYRNQ*WGYEGSLLVLNFYIL 149 LFC +AV CW WYE + Y S L +NF +L Sbjct: 164 LFCFWSFAVSACWVWYEALNDQE---YIDSFLPVNFIML 199
>YSR4_CAEEL (Q09952) Hypothetical protein F59B10.4| Length = 267 Score = 30.8 bits (68), Expect = 2.2 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -3 Query: 265 LFCILLYAVLVCWRWYEQSYRNQ*WGYEGSLLVLNFYILLMQGYQASSKVESVWLAAIIW 86 LF ++LY + Y S+ +L ++NF ++L+ +SKV S+ L A++W Sbjct: 55 LFAVMLYLI------YPDSF------LPSTLFIVNFSLVLLALLGINSKVSSMILPALVW 102 Query: 85 K 83 K Sbjct: 103 K 103
>PQQD_SILPO (Q5LTB3) Coenzyme PQQ synthesis protein D (Pyrroloquinoline quinone| biosynthesis protein D) Length = 95 Score = 30.8 bits (68), Expect = 2.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 425 RPFLPRGRRLIIDRDTGGFV 366 RP+LPRG RL+ DR GG V Sbjct: 10 RPYLPRGVRLVTDRVRGGIV 29 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,893,673 Number of Sequences: 219361 Number of extensions: 1421717 Number of successful extensions: 3017 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3017 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)