Clone Name | rbastl01d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CRCB_ANASP (Q8YRV2) Protein crcB homolog | 28 | 6.7 | 2 | SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains pro... | 28 | 6.7 | 3 | IF4G1_MOUSE (Q6NZJ6) Eukaryotic translation initiation factor 4 ... | 28 | 8.8 | 4 | PRP45_DEBHA (Q6BV91) Pre-mRNA-splicing factor PRP45 (Pre-mRNA-pr... | 28 | 8.8 | 5 | WT1_PIG (O62651) Wilms' tumor protein homolog | 28 | 8.8 | 6 | WT1_HUMAN (P19544) Wilms' tumor protein (WT33) | 28 | 8.8 |
---|
>CRCB_ANASP (Q8YRV2) Protein crcB homolog| Length = 157 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 201 RNILATGSEWAASGVIGRTSNVIGFLM 281 RN+LA G WA S ++G S IG ++ Sbjct: 126 RNLLAAGFYWAGSSILGVISIQIGIIL 152
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 354 GQVFGFASTPGSPPLPPDL 298 GQ FG +STPG PP PP L Sbjct: 1734 GQAFGGSSTPG-PPYPPQL 1751
>IF4G1_MOUSE (Q6NZJ6) Eukaryotic translation initiation factor 4 gamma 1| (eIF-4-gamma 1) (eIF-4G1) (eIF-4G 1) Length = 1600 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 275 PDDLSQCLRSGGRGGEPGVEAKPKT 349 PDD SQ GGR G PG E P T Sbjct: 239 PDDRSQGAAIGGRPGLPGPEHSPGT 263
>PRP45_DEBHA (Q6BV91) Pre-mRNA-splicing factor PRP45 (Pre-mRNA-processing| protein 45) Length = 341 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 191 KYS*KHPSYRFRVGSVRRHRKNIQCDRLPDDLS 289 KYS P+ R ++ VR H K+ Q +LP++ S Sbjct: 10 KYSSHEPTSRIKLKKVRAHEKSNQLVKLPENKS 42
>WT1_PIG (O62651) Wilms' tumor protein homolog| Length = 449 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 372 PTASAHGQVFGFASTPGSPPLPPDLKH 292 P ASA+G + G A P PP PP H Sbjct: 43 PGASAYGSLGGPAPPPAPPPPPPPPPH 69
>WT1_HUMAN (P19544) Wilms' tumor protein (WT33)| Length = 449 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 372 PTASAHGQVFGFASTPGSPPLPPDLKH 292 P ASA+G + G A P PP PP H Sbjct: 43 PGASAYGSLGGPAPPPAPPPPPPPPPH 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,912,452 Number of Sequences: 219361 Number of extensions: 1136177 Number of successful extensions: 2958 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2958 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)