Clone Name | rbastl01c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YT24_CAEEL (Q10933) Hypothetical protein B0304.4 | 28 | 8.8 |
---|
>YT24_CAEEL (Q10933) Hypothetical protein B0304.4| Length = 128 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +3 Query: 258 ANIKSKRCRVSVGQSCHFAACSITDILVHLSCSSGALLP*RGGKEKALTVEL 413 A+IK++ C ++G+ + C V LSC+ A L GKEK +L Sbjct: 49 ADIKNRVCSAAIGRVNFVSKCLKKFPEVSLSCNISASLSLNTGKEKVKNEDL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,892,703 Number of Sequences: 219361 Number of extensions: 1183880 Number of successful extensions: 2372 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2372 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)