Clone Name | rbastl01b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YB35_SCHPO (O14340) Oxysterol-binding protein homolog C2F12.05c | 31 | 1.0 | 2 | GCYA3_HUMAN (Q02108) Guanylate cyclase soluble subunit alpha-3 (... | 28 | 8.6 | 3 | DEPP_PONPY (Q5RBE4) Protein DEPP | 28 | 8.6 | 4 | DEPP_HUMAN (Q9NTK1) Protein DEPP (Decidual protein induced by pr... | 28 | 8.6 |
---|
>YB35_SCHPO (O14340) Oxysterol-binding protein homolog C2F12.05c| Length = 1310 Score = 31.2 bits (69), Expect = 1.0 Identities = 26/114 (22%), Positives = 49/114 (42%), Gaps = 14/114 (12%) Frame = +3 Query: 18 FVIKNNISKEYNN------------NVSVSTIVHEPLQKSTHPYLQTVTRRTSPHTKENG 161 F + N + Y N N+ ++ +VH+P Q + + + R S K N Sbjct: 276 FTLNNGVLSYYKNQDDASSACRGSINLKLARLVHDPKQPTVFQVIGKGSVRYS--VKANS 333 Query: 162 -IEGKPCIQS*ATAVXXXXXXXXXNITGDHRREASQEMRSSSGKFTE-QAEGQS 317 +E K I + ++A+ N+T D+ + ++ ++ KFT+ A G S Sbjct: 334 PVEAKKWIAAISSAIENDEEANKPNVTADNASFGTHDLAPAAHKFTQSNASGNS 387
>GCYA3_HUMAN (Q02108) Guanylate cyclase soluble subunit alpha-3 (EC 4.6.1.2)| (GCS-alpha-3) (Soluble guanylate cyclase large subunit) (GCS-alpha-1) Length = 690 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 370 QEILSRKKSSR*LVIAH*LWPSACSVNLPELDRIS 266 QE L ++K+SR V H L S C + PE +R++ Sbjct: 56 QESLPQRKTSRSRVYLHTLAESICKLIFPEFERLN 90
>DEPP_PONPY (Q5RBE4) Protein DEPP| Length = 212 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 205 LLLAPCSVPTLQETTEEKHLKKCGQAP 285 LLL+ +PT++ETTEE L GQ P Sbjct: 5 LLLSVAHLPTIRETTEEMLLGGPGQEP 31
>DEPP_HUMAN (Q9NTK1) Protein DEPP (Decidual protein induced by progesterone)| (Fasting-induced gene protein) (FIG) Length = 212 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 205 LLLAPCSVPTLQETTEEKHLKKCGQAP 285 LLL+ +PT++ETTEE L GQ P Sbjct: 5 LLLSVAHLPTIRETTEEMLLGGPGQEP 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,236,971 Number of Sequences: 219361 Number of extensions: 1104505 Number of successful extensions: 2912 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2912 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)