Clone Name | rbastl01b07 |
---|---|
Clone Library Name | barley_pub |
>SYL_ZYMMO (Q5NMK1) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 846 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 375 RFCTRALQTVTRLNLKEKF 319 RF TRALQ++ RL++KE F Sbjct: 553 RFWTRALQSIGRLDIKEPF 571
>STAT_DROME (Q24151) Signal transducer and transcription activator (Protein| marelle) (d-STAT) Length = 761 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 185 QPKVISGAFQRLRETIHTHHCRKGTNAAPSCASH 286 +P V+ ++ T+H H CR G N + S H Sbjct: 701 EPLVLDPVTGYVKSTLHVHVCRNGENGSTSGTPH 734
>CH60_CYAME (Q85G22) 60 kDa chaperonin (Protein Cpn60) (groEL protein)| Length = 526 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 223 GNDSHTSLSEGNKCSSQLCLTQGVRF 300 G D SL EG +QL +TQG+RF Sbjct: 169 GADGVISLEEGKSSQTQLQITQGMRF 194
>SBCD_BORBU (O51769) Exonuclease sbcD homolog| Length = 413 Score = 27.7 bits (60), Expect = 6.9 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 198 FLVPFNVFGKRFTHITVG 251 +++PFNVFG F+++ +G Sbjct: 211 YIIPFNVFGNGFSYVALG 228
>SIGIR_HUMAN (Q6IA17) Single Ig IL-1-related receptor (Single Ig IL-1R-related| molecule) (Single immunoglobulin domain-containing IL1R-related protein) (Toll/interleukin-1 receptor 8) (TIR8) Length = 410 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 18 SSKSNLSNIGRRSYNCRTSTYCSI 89 SS+ ++S++G R+Y+ RT YC + Sbjct: 382 SSEVDVSDLGSRNYSARTDFYCLV 405
>HEMH_HORVU (P42045) Ferrochelatase-2, chloroplast precursor (EC 4.99.1.1)| (Ferrochelatase II) (Protoheme ferro-lyase 2) (Heme synthetase 2) Length = 484 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = -3 Query: 383 KSVDSARGLCKP*QGSIXXXXXXXXXXXXRTPCVRHSWELHLFPSDSDVCESFPEDVE 210 K + G KP S R+P ++H L + + +DVC +F EDV+ Sbjct: 41 KCEQNLHGKAKPLLLSASGKARGTSGLVHRSPVLKHQHHLSVRSTSTDVCTTFDEDVK 98
>PRLHR_HUMAN (P49683) Prolactin-releasing peptide receptor (PrRP receptor)| (PrRPR) (G-protein coupled receptor 10) (hGR3) Length = 370 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 290 PCVRHSWELHLFPSDSDVCESFPEDVERHQKLLWAELILLVISAP 156 P H++ + L P D +CE F ER ++L L+L+ P Sbjct: 193 PAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLP 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,322,033 Number of Sequences: 219361 Number of extensions: 783870 Number of successful extensions: 1997 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1997 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)