Clone Name | rbart61h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZN198_HUMAN (Q9UBW7) Zinc finger protein 198 (Zinc finger MYM-ty... | 28 | 4.9 |
---|
>ZN198_HUMAN (Q9UBW7) Zinc finger protein 198 (Zinc finger MYM-type protein 2)| (Fused in myeloproliferative disorders protein) (Rearranged in atypical myeloproliferative disorder protein) Length = 1377 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = -3 Query: 203 DWYRGSRRCHCCGF--LITKTNQWRKHGQHM--ESCFLR 99 DWY + RC CC + + QWR +H + C LR Sbjct: 760 DWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLR 798 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,189,026 Number of Sequences: 219361 Number of extensions: 686789 Number of successful extensions: 1886 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1886 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)