ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart61h02 |
|---|---|
| Clone Library Name | barley_pub |
>SPD1_ARATH (Q9ZUB3) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 334 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKAN 237 H+A+FCLPSFA++VIE+KAN Sbjct: 315 HSAAFCLPSFAKKVIESKAN 334
>SPD1_ORYSA (Q9SMB1) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 323 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKAN 237 H+ASFCLPSFA+RVI +KAN Sbjct: 304 HSASFCLPSFAKRVIGSKAN 323
>SPD2_ARATH (O48661) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 340 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/20 (70%), Positives = 20/20 (100%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKAN 237 H+A+FCLPSFA++VI++KAN Sbjct: 321 HSAAFCLPSFAKKVIDSKAN 340
>SPDE_COFAR (O82147) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 316 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/20 (70%), Positives = 20/20 (100%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKAN 237 H+A+FCLPSFA++VI++KAN Sbjct: 297 HSAAFCLPSFAKKVIDSKAN 316
>SPD1_DATST (Q96556) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 308 Score = 36.6 bits (83), Expect = 0.017 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 H+ASFCLPSFA+RVIE+K Sbjct: 289 HSASFCLPSFAKRVIESK 306
>SPD2_HYONI (O48659) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 308 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKA 240 H+ASFCLPSFA+RVIE+ A Sbjct: 289 HSASFCLPSFAKRVIESNA 307
>SPDE_NICSY (O48660) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (Aminopropyltransferase) Length = 314 Score = 35.8 bits (81), Expect = 0.028 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 H ASFCLPSFA+RVIE+K Sbjct: 295 HKASFCLPSFAKRVIESK 312
>SPD1_HYONI (O48658) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 315 Score = 35.8 bits (81), Expect = 0.028 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 H ASFCLPSFA+RVIE+K Sbjct: 296 HQASFCLPSFAKRVIESK 313
>SPDE_LYCES (Q9ZS45) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 342 Score = 35.4 bits (80), Expect = 0.037 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 H ASFCLPSFA+RVIE K Sbjct: 323 HQASFCLPSFAKRVIETK 340
>SPD2_DATST (Q96557) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 317 Score = 35.4 bits (80), Expect = 0.037 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 H ASFCLPSFA+RVIE K Sbjct: 298 HQASFCLPSFAKRVIETK 315
>SPD1_PEA (Q9ZTR1) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 334 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAKAN 237 H+A+FCLPSFA+R I +K N Sbjct: 315 HSAAFCLPSFAKRAIASKEN 334
>SPD2_PEA (Q9ZTR0) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 342 Score = 32.0 bits (71), Expect = 0.41 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -2 Query: 296 HTASFCLPSFARRVIEAK 243 HTA+FCLPSFA+R I +K Sbjct: 323 HTAAFCLPSFAKRKIGSK 340
>LGT_SYNP6 (Q5N5A8) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 289 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 99 PWKLLVPVNQSVVLCLRF-YFLATWWYENVLNL 4 PWKL +P+++ + ++ YF T+ YE++ NL Sbjct: 160 PWKLFIPIDRRPLAYIQSEYFHPTFLYESLWNL 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,261,418 Number of Sequences: 219361 Number of extensions: 772687 Number of successful extensions: 1199 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
