Clone Name | rbart61g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HRPH_PSESY (Q01723) Hypersensitivity response secretion protein ... | 30 | 1.9 | 2 | ITPA_MOUSE (Q9D892) Inosine triphosphate pyrophosphatase (EC 3.6... | 29 | 3.3 | 3 | VGLE_HHV1F (Q703F0) Glycoprotein E precursor | 27 | 9.6 |
---|
>HRPH_PSESY (Q01723) Hypersensitivity response secretion protein hrpH precursor| Length = 701 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 346 CGGNQSWRRW*LVEDRLWFQPGHPSDHYHHPRSPRVDKVEKQQR 215 CGG W W QPG S+ Y R P++ K+ K+ R Sbjct: 651 CGGR--WVIGVAAWPHAWLQPGEESEVYIAVRQPQISKMAKESR 692
>ITPA_MOUSE (Q9D892) Inosine triphosphate pyrophosphatase (EC 3.6.1.19)| (ITPase) (Inosine triphosphatase) Length = 198 Score = 28.9 bits (63), Expect = 3.3 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +1 Query: 175 NPNQA*LVCRRRRTAVVFPPCPHEDFEGDDSDQKDGQVETIADLPRVTSASNFDSH 342 +P+Q L+ R + + + P DF D Q DG +T A++P+ S N SH Sbjct: 124 DPSQPVLLFRGQTSGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPK--SEKNTISH 177
>VGLE_HHV1F (Q703F0) Glycoprotein E precursor| Length = 552 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 229 PPCPHEDFEGDDSDQKDGQVETIADLP 309 PP P D++ DD+D+ +G+ E++A P Sbjct: 170 PPTP-ADYDEDDNDEGEGEDESLAGTP 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,069,987 Number of Sequences: 219361 Number of extensions: 877942 Number of successful extensions: 2333 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2332 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)