ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
Japanese | English
更新日：2016年5月1日

Clone Information

BLAST Search Result

Clone Name rbart61e02
Clone Library Name barley_pub
No. Definition Score
(bits)		 E
Value
1ACT_THELA (P10365) Actin 28 4.2
2ACT_SCHDU (O65314) Actin 28 4.2
3ACT_PUCGR (P50138) Actin 28 4.2
4ACT_PHYME (P13363) Actin 28 4.2
5ACT_NEUCR (P78711) Actin 28 4.2
6ACT_GAEGA (Q6TCF2) Actin 28 4.2
7ACT_FUCDI (P53502) Actin 28 4.2
8ACT_EXODE (Q8X119) Actin 28 4.2
9ACT_CRYNV (P48465) Actin 28 4.2
10ACT_BOTCI (O13419) Actin 28 4.2
11ACT_AJECA (P53455) Actin 28 4.2
12ACTM_STYPL (Q00214) Actin, muscle 28 4.2
13ACTG_TRIVU (P63257) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
14ACTG_RAT (P63259) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
15ACTG_PENCH (Q9URS0) Actin, gamma 28 4.2
16ACTG_MOUSE (P63260) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
17ACTG_HUMAN (P63261) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
18ACTG_EMENI (P20359) Actin, gamma 28 4.2
19ACTG_CEPAC (Q9UVW9) Actin, gamma 28 4.2
20ACTG_BOVIN (P63258) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
21ACTG_ANSAN (P63256) Actin, cytoplasmic 2 (Gamma-actin) 28 4.2
22ACTC_STYPL (Q00215) Actin, cytoplasmic 28 4.2
23ACTC_BRALA (O17503) Actin, cytoplasmic 28 4.2
24ACTC_BRAFL (Q93131) Actin, cytoplasmic (BfCA1) 28 4.2
25ACTC_BRABE (Q93129) Actin, cytoplasmic (BbCA1) 28 4.2
26ACTB_XENLA (O93400) Actin, cytoplasmic 1 (Beta-actin) (Cytoplasm... 28 4.2
27ACTB_TRIVU (P60707) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
28ACTB_SIGHI (Q91ZK5) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
29ACTB_SHEEP (P60713) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
30ACTB_SALSA (O42161) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
31ACTB_RAT (P60711) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
32ACTB_RABIT (P29751) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
33ACTB_PANTR (Q5R1X3) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
34ACTB_ORYLA (P79818) Actin, cytoplasmic 1 (Beta-actin) (OlCA1) 28 4.2
35ACTB_OREMO (P68143) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
36ACTB_MOUSE (P60710) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
37ACTB_MESAU (Q711N9) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
38ACTB_HUMAN (P60709) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
39ACTB_HORSE (P60708) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
40ACTB_CYPCA (P83750) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
41ACTB_CTEID (P83751) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
42ACTB_CRIGR (P48975) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
43ACTB_CHICK (P60706) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
44ACTB_CERAE (Q76N69) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
45ACTB_CAVPO (Q71FK5) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
46ACTB_CANFA (O18840) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
47ACTB_CAMDR (P84336) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
48ACTB_BOVIN (P60712) Actin, cytoplasmic 1 (Beta-actin) 28 4.2
49ACTB2_BRARE (Q7ZVF9) Actin, cytoplasmic 2 (Beta-actin-2) 28 4.2
50ACTB1_BRARE (Q7ZVI7) Actin, cytoplasmic 1 (Beta-actin-1) 28 4.2
51ACTA_PHYPO (P02576) Actin, plasmodial isoform 28 4.2
52ACT8_DICDI (P07830) Actin-15 (Actin A8) (Actin-1/100/103) 28 4.2
53ACT3_FUGRU (P53486) Actin, cytoplasmic 3 (Beta-actin-3) 28 4.2
54ACT3_DICDI (P07829) Actin-3-sub 1 28 4.2
55ACT2_PHYIN (P22132) Actin-2 28 4.2
56ACT2_MOLOC (Q25472) Actin, muscle-type (A2) 28 4.2
57ACT2_FUGRU (P53485) Actin, cytoplasmic 2 (Beta-actin-2) 28 4.2
58ACT2_DICDI (P07827) Actin A12 28 4.2
59ACT1_TETTH (P10992) Actin, macronuclear 28 4.2
60ACT1_PLABA (Q4Z1L3) Actin-1 (Actin I) 28 4.2
61ACT1_FUGRU (P68142) Actin, cytoplasmic 1 (Beta-actin-1) 28 4.2
62ACT1_ECHGR (P35432) Actin-1 28 4.2
63ACT1_DICDI (P02577) Actin 28 4.2
64ACT1_ACACA (P02578) Actin-1 28 4.2
65ACT_VOLCA (P20904) Actin 28 4.2
66ACT_MESVI (O65316) Actin 28 4.2
67ACT_GOSHI (O81221) Actin 28 4.2
68ACT_DICVI (Q24733) Actin (Fragment) 28 4.2
69ACT_COLSC (O65315) Actin 28 4.2
70ACT_CHLRE (P53498) Actin 28 4.2
71ACT7_SOLTU (P30169) Actin-75 28 4.2
72ACT7_ARATH (P53492) Actin-7 (Actin-2) 28 4.2
73ACT6_SOLTU (P30168) Actin-71 28 4.2
74ACT4_ARATH (P53494) Actin-4 28 4.2
75ACT3_SOLTU (P30167) Actin-58 28 4.2
76ACT3_PEA (P46258) Actin-3 28 4.2
77ACT3_ORYSA (P17299) Actin-3 28 4.2
78ACT2_ABSGL (P26197) Actin-2 28 4.2
79ACT1_TOBAC (Q05214) Actin 28 4.2
80ACT1_SORBI (P53504) Actin-1 28 4.2
81ACT1_ORYSA (P13362) Actin-1 28 4.2
82ACT1_ARATH (P10671) Actin-1/3 28 4.2
83ACT13_SOLTU (P30173) Actin-101 28 4.2
84ACT12_ARATH (P53497) Actin-12 28 4.2
85ACT11_SOLTU (P30171) Actin-97 28 4.2
86ACT11_ARATH (P53496) Actin-11 28 4.2
87ACT2_DAUCA (P23344) Actin-2 28 4.2
88ACT3_ECHGR (Q03342) Actin-3 (Fragment) 28 4.2
89ACT_TOXGO (P53476) Actin 28 4.2
90ACT_PLAMG (Q26065) Actin, adductor muscle 28 4.2
91ACT_LUMRU (P91754) Actin (Fragment) 28 4.2
92ACT_HYDAT (P17126) Actin, non-muscle 6.2 28 4.2
93ACT_FUCVE (Q39758) Actin 28 4.2
94ACT_CRYPV (P26183) Actin 28 4.2
95ACT_CRAGI (O17320) Actin 28 4.2
96ACT_COSCS (P30161) Actin (Fragment) 28 4.2
97ACT_ACHBI (P26182) Actin 28 4.2
98ACTY_LIMPO (P41341) Actin-11 28 4.2
99ACTM_PISOC (P12717) Actin, muscle 28 4.2
100ACTM_HELTB (P53464) Actin, cytoskeletal (M) 28 4.2
101ACTM_HELER (P53463) Actin, cytoskeletal (M) 28 4.2
102ACTM_APLCA (P17304) Actin, muscle 28 4.2
103ACTF_STRPU (P18499) Actin, cytoskeletal IIIB 28 4.2
104ACTE_STRPU (P53474) Actin, cytoskeletal IIIA 28 4.2
105ACTD_STRPU (P69005) Actin, cytoskeletal IIB 28 4.2
106ACTC_STRPU (Q07903) Actin, cytoskeletal IIA 28 4.2
107ACTC_PISOC (P12716) Actin, cytoplasmic 28 4.2
108ACTC_HELTI (Q964D9) Actin, cytoplasmic 28 4.2
109ACTC_HALRO (P53461) Actin, nonmuscle 28 4.2
110ACTC_BIOTE (Q964E0) Actin, cytoplasmic 28 4.2
111ACTC_BIOPF (Q964E2) Actin, cytoplasmic 28 4.2
112ACTC_BIOOB (Q964E1) Actin, cytoplasmic 28 4.2
113ACTC_BIOGL (P92179) Actin, cytoplasmic 28 4.2
114ACTC_BIOAL (Q964E3) Actin, cytoplasmic 28 4.2
115ACTB_XENBO (P15475) Actin, cytoplasmic 1 (Beta actin) 28 4.2
116ACTB_STRPU (P53473) Actin, cytoskeletal IB 28 4.2
117ACTA_STRPU (P53472) Actin, cytoskeletal IA 28 4.2
118ACTA_LIMPO (P41339) Actin, acrosomal process isoform (Actin-5) 28 4.2
119ACT8_XENLA (P53506) Actin, cytoplasmic type 8 28 4.2
120ACT5_XENLA (P53505) Actin, cytoplasmic type 5 28 4.2
121ACT5_CHICK (P53478) Actin, cytoplasmic type 5 28 4.2
122ACT5C_ANOGA (P84185) Actin-5C (Actin-1D, cytoplasmic) 28 4.2
123ACT4_CAEEL (P10986) Actin-4 28 4.2
124ACT4_BOMMO (P84183) Actin, cytoplasmic A4 28 4.2
125ACT4_ARTSX (P18603) Actin, clone 403 28 4.2
126ACT3_SOYBN (P02580) Actin-3 28 4.2
127ACT3_PODCA (P41113) Actin-3 28 4.2
128ACT3_LIMPO (P41340) Actin-3 28 4.2
129ACT3_BOMMO (P04829) Actin, cytoplasmic A3 28 4.2
130ACT3B_HELAM (P84184) Actin-A3b, cytoplasmic 28 4.2
131ACT3A_HELAM (Q25010) Actin, cytoplasmic A3a 28 4.2
132ACT2_TETPY (P10993) Actin, cytoplasmic (Actin, micronuclear) 28 4.2
133ACT2_STRFN (P69004) Actin-15B 28 4.2
134ACT2_SACKO (O18500) Actin-2 28 4.2
135ACT2_PLAYO (Q7RPB4) Actin-2 (Actin II) 28 4.2
136ACT2_PLAFA (P14883) Actin-2 (Actin II) 28 4.2
137ACT2_PLAF7 (Q8ILW9) Actin-2 (Actin II) 28 4.2
138ACT2_PLABA (Q4YU79) Actin-2 (Actin II) 28 4.2
139ACT2_ONCVO (P30163) Actin-2 28 4.2
140ACT2_LYTPI (P53466) Actin, cytoskeletal 2 (LPC2) 28 4.2
141ACT2_LUMTE (P92176) Actin-2 28 4.2
142ACT2_DROME (P02572) Actin-42A 28 4.2
143ACT2_CAEEL (P10984) Actin-2 28 4.2
144ACT1_STRFN (P10990) Actin-15A 28 4.2
145ACT1_SACKO (O18499) Actin-1 28 4.2
146ACT1_PODCA (P41112) Actin-1/2 28 4.2
147ACT1_PLAYO (Q7RME1) Actin-1 (Actin I) 28 4.2
148ACT1_PLAFA (P10988) Actin-1 (Actin I) 28 4.2
149ACT1_PLAF7 (Q8I4X0) Actin-1 (Actin I) 28 4.2
150ACT1_PHYIN (P22131) Actin-1 28 4.2
151ACT1_ONCVO (P30162) Actin-1 28 4.2
152ACT1_LYTPI (P53465) Actin, cytoskeletal 1 (LPC1) 28 4.2
153ACT1_LUMTE (P92182) Actin-1 28 4.2
154ACT1_HELTB (P69003) Actin CyI, cytoplasmic 28 4.2
155ACT1_HELER (P69002) Actin CyI, cytoplasmic 28 4.2
156ACT1_DROME (P10987) Actin-5C 28 4.2
157ACT1_CAEEL (P10983) Actin-1/3 28 4.2
158ACT12_SOLTU (P30172) Actin-100 (Fragment) 28 4.2
159ACT_PINCO (P24902) Actin (Fragment) 28 4.2
160ACT3_ARTSX (P18602) Actin, clone 302 (Fragment) 28 4.2
161ACT6_DIPDE (P53459) Actin-6 (Fragment) 28 4.2
162ACTM_LYTPI (Q25381) Actin, muscle (LPM) (Fragment) 28 4.2
163ACT3_LYTPI (Q25379) Actin, cytoskeletal 3 (LPC3) (Fragment) 28 4.2
164KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing prot... 28 5.4
165UFOG_SOLME (Q43641) Anthocyanidin 3-O-glucosyltransferase (EC 2.... 28 7.1
166ACT_PHARH (P53689) Actin 27 9.3
167ACTN_STYCL (P53475) Actin, muscle 27 9.3
168ACTM_STYCL (P26198) Actin, muscle 27 9.3
169ACTM_MOLOC (P53467) Actin, larval muscle-type (A1) 27 9.3
170ACTM_CIOSA (O15998) Actin, muscle 27 9.3
171ACT2_HALRO (P27130) Actin, muscle 2/4/4A 27 9.3
172ACT1_HALRO (P53460) Actin, muscle 1A 27 9.3
173ACTT_FUGRU (P53482) Actin, alpha skeletal muscle 2 27 9.3
174ACTS_RAT (P68136) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
175ACTS_RABIT (P68135) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
176ACTS_PIG (P68137) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
177ACTS_OREMO (P68264) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
178ACTS_MOUSE (P68134) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
179ACTS_HUMAN (P68133) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
180ACTS_FUGRU (P68140) Actin, alpha skeletal muscle 1 27 9.3
181ACTS_CYPCA (P53479) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
182ACTS_CHICK (P68139) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
183ACTS_CARAU (P49055) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
184ACTS_BOVIN (P68138) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
185ACTS_ATRMM (Q90X97) Actin, alpha skeletal muscle (Alpha-actin-1) 27 9.3
186ACTC_RAT (P68035) Actin, alpha cardiac (Alpha-cardiac actin) 27 9.3
187ACTC_MOUSE (P68033) Actin, alpha cardiac (Alpha-cardiac actin) 27 9.3
188ACTC_HUMAN (P68032) Actin, alpha cardiac (Alpha-cardiac actin) 27 9.3
189ACTC_FUGRU (P53480) Actin, alpha cardiac 27 9.3
190ACTC_CHICK (P68034) Actin, alpha cardiac (Alpha-cardiac actin) 27 9.3
191ACTA_RAT (P62738) Actin, aortic smooth muscle (Alpha-actin-2) 27 9.3
192ACTA_RABIT (P62740) Actin, aortic smooth muscle (Alpha-actin-2) 27 9.3
193ACTA_MOUSE (P62737) Actin, aortic smooth muscle (Alpha-actin-2) 27 9.3
194ACTA_HUMAN (P62736) Actin, aortic smooth muscle (Alpha-actin-2) 27 9.3
195ACTA_CHICK (P08023) Actin, aortic smooth muscle (Alpha-actin) 27 9.3
196ACTA_BOVIN (P62739) Actin, aortic smooth muscle (Alpha-actin-2) 27 9.3
197ACT3_XENLA (P04752) Actin, alpha sarcomeric/skeletal (Actin alph... 27 9.3
198ACT3_DIPDE (P53457) Actin-3 27 9.3
199ACT2_XENTR (P20399) Actin, alpha sarcomeric/cardiac (Actin alpha 2) 27 9.3
200ACT2_XENLA (P10995) Actin, alpha sarcomeric/cardiac (Actin alpha 2) 27 9.3
201ACT2_ORYSA (P17298) Actin-2 27 9.3
202ACT1_XENLA (P04751) Actin, alpha cardiac muscle (Actin alpha 1) 27 9.3
203ACT1_SOYBN (P02581) Actin-1 27 9.3
204ACT1_ORYLA (Q98972) Actin, muscle-type (OlMA1) 27 9.3
205ACT_ENTHI (P11426) Actin 27 9.3
206ACTH_RAT (P63269) Actin, gamma-enteric smooth muscle (Smooth mus... 27 9.3
207ACTH_MOUSE (P63268) Actin, gamma-enteric smooth muscle (Smooth m... 27 9.3
208ACTH_HUMAN (P63267) Actin, gamma-enteric smooth muscle (Smooth m... 27 9.3
209ACTH_CHICK (P63270) Actin, gamma-enteric smooth muscle (Smooth m... 27 9.3
210ACT1_AEDAE (P49128) Actin-1 27 9.3
211ACTS_PLEWA (P10994) Actin, alpha skeletal muscle (Fragment) 27 9.3 
>ACT_THELA (P10365) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_SCHDU (O65314) Actin|
          Length = 378

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 368 SGPSIVHRKCF 378
to top
>ACT_PUCGR (P50138) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_PHYME (P13363) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_NEUCR (P78711) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_GAEGA (Q6TCF2) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_FUCDI (P53502) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_EXODE (Q8X119) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_CRYNV (P48465) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_BOTCI (O13419) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_AJECA (P53455) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTM_STYPL (Q00214) Actin, muscle|
          Length = 379

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 369 SGPSIVHRKCF 379
to top
>ACTG_TRIVU (P63257) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_RAT (P63259) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_PENCH (Q9URS0) Actin, gamma|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_MOUSE (P63260) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_HUMAN (P63261) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_EMENI (P20359) Actin, gamma|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_CEPAC (Q9UVW9) Actin, gamma|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_BOVIN (P63258) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTG_ANSAN (P63256) Actin, cytoplasmic 2 (Gamma-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTC_STYPL (Q00215) Actin, cytoplasmic|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTC_BRALA (O17503) Actin, cytoplasmic|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTC_BRAFL (Q93131) Actin, cytoplasmic (BfCA1)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTC_BRABE (Q93129) Actin, cytoplasmic (BbCA1)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_XENLA (O93400) Actin, cytoplasmic 1 (Beta-actin) (Cytoplasmic beta actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_TRIVU (P60707) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_SIGHI (Q91ZK5) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_SHEEP (P60713) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_SALSA (O42161) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_RAT (P60711) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_RABIT (P29751) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_PANTR (Q5R1X3) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_ORYLA (P79818) Actin, cytoplasmic 1 (Beta-actin) (OlCA1)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_OREMO (P68143) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_MOUSE (P60710) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_MESAU (Q711N9) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_HUMAN (P60709) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_HORSE (P60708) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CYPCA (P83750) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CTEID (P83751) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CRIGR (P48975) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CHICK (P60706) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CERAE (Q76N69) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CAVPO (Q71FK5) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CANFA (O18840) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_CAMDR (P84336) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB_BOVIN (P60712) Actin, cytoplasmic 1 (Beta-actin)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB2_BRARE (Q7ZVF9) Actin, cytoplasmic 2 (Beta-actin-2)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTB1_BRARE (Q7ZVI7) Actin, cytoplasmic 1 (Beta-actin-1)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACTA_PHYPO (P02576) Actin, plasmodial isoform|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT8_DICDI (P07830) Actin-15 (Actin A8) (Actin-1/100/103)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT3_FUGRU (P53486) Actin, cytoplasmic 3 (Beta-actin-3)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT3_DICDI (P07829) Actin-3-sub 1|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT2_PHYIN (P22132) Actin-2|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT2_MOLOC (Q25472) Actin, muscle-type (A2)|
          Length = 378

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 368 SGPSIVHRKCF 378
to top
>ACT2_FUGRU (P53485) Actin, cytoplasmic 2 (Beta-actin-2)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT2_DICDI (P07827) Actin A12|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_TETTH (P10992) Actin, macronuclear|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_PLABA (Q4Z1L3) Actin-1 (Actin I)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_FUGRU (P68142) Actin, cytoplasmic 1 (Beta-actin-1)|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_ECHGR (P35432) Actin-1|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_DICDI (P02577) Actin|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT1_ACACA (P02578) Actin-1|
          Length = 375

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 365 SGPSIVHRKCF 375
to top
>ACT_VOLCA (P20904) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT_MESVI (O65316) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT_GOSHI (O81221) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT_DICVI (Q24733) Actin (Fragment)|
          Length = 33

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 23  SGPSIVHRKCF 33
to top
>ACT_COLSC (O65315) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT_CHLRE (P53498) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT7_SOLTU (P30169) Actin-75|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT7_ARATH (P53492) Actin-7 (Actin-2)|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT6_SOLTU (P30168) Actin-71|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT4_ARATH (P53494) Actin-4|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT3_SOLTU (P30167) Actin-58|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT3_PEA (P46258) Actin-3|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT3_ORYSA (P17299) Actin-3|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT2_ABSGL (P26197) Actin-2|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT1_TOBAC (Q05214) Actin|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT1_SORBI (P53504) Actin-1|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT1_ORYSA (P13362) Actin-1|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT1_ARATH (P10671) Actin-1/3|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT13_SOLTU (P30173) Actin-101|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT12_ARATH (P53497) Actin-12|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT11_SOLTU (P30171) Actin-97|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT11_ARATH (P53496) Actin-11|
          Length = 377

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 367 SGPSIVHRKCF 377
to top
>ACT2_DAUCA (P23344) Actin-2|
          Length = 381

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 371 SGPSIVHRKCF 381
to top
>ACT3_ECHGR (Q03342) Actin-3 (Fragment)|
          Length = 309

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 299 SGPSIVHRKCF 309
to top
>ACT_TOXGO (P53476) Actin|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_PLAMG (Q26065) Actin, adductor muscle|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_LUMRU (P91754) Actin (Fragment)|
          Length = 372

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 362 SGPSIVHRKCF 372
to top
>ACT_HYDAT (P17126) Actin, non-muscle 6.2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_FUCVE (Q39758) Actin|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_CRYPV (P26183) Actin|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_CRAGI (O17320) Actin|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT_COSCS (P30161) Actin (Fragment)|
          Length = 331

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 321 SGPSIVHRKCF 331
to top
>ACT_ACHBI (P26182) Actin|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTY_LIMPO (P41341) Actin-11|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTM_PISOC (P12717) Actin, muscle|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTM_HELTB (P53464) Actin, cytoskeletal (M)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTM_HELER (P53463) Actin, cytoskeletal (M)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTM_APLCA (P17304) Actin, muscle|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTF_STRPU (P18499) Actin, cytoskeletal IIIB|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTE_STRPU (P53474) Actin, cytoskeletal IIIA|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTD_STRPU (P69005) Actin, cytoskeletal IIB|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_STRPU (Q07903) Actin, cytoskeletal IIA|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_PISOC (P12716) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_HELTI (Q964D9) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_HALRO (P53461) Actin, nonmuscle|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_BIOTE (Q964E0) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_BIOPF (Q964E2) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_BIOOB (Q964E1) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_BIOGL (P92179) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTC_BIOAL (Q964E3) Actin, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTB_XENBO (P15475) Actin, cytoplasmic 1 (Beta actin)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTB_STRPU (P53473) Actin, cytoskeletal IB|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTA_STRPU (P53472) Actin, cytoskeletal IA|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACTA_LIMPO (P41339) Actin, acrosomal process isoform (Actin-5)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT8_XENLA (P53506) Actin, cytoplasmic type 8|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT5_XENLA (P53505) Actin, cytoplasmic type 5|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT5_CHICK (P53478) Actin, cytoplasmic type 5|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT5C_ANOGA (P84185) Actin-5C (Actin-1D, cytoplasmic)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT4_CAEEL (P10986) Actin-4|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT4_BOMMO (P84183) Actin, cytoplasmic A4|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT4_ARTSX (P18603) Actin, clone 403|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3_SOYBN (P02580) Actin-3|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3_PODCA (P41113) Actin-3|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3_LIMPO (P41340) Actin-3|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3_BOMMO (P04829) Actin, cytoplasmic A3|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3B_HELAM (P84184) Actin-A3b, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT3A_HELAM (Q25010) Actin, cytoplasmic A3a|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_TETPY (P10993) Actin, cytoplasmic (Actin, micronuclear)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_STRFN (P69004) Actin-15B|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_SACKO (O18500) Actin-2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_PLAYO (Q7RPB4) Actin-2 (Actin II)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_PLAFA (P14883) Actin-2 (Actin II)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_PLAF7 (Q8ILW9) Actin-2 (Actin II)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_PLABA (Q4YU79) Actin-2 (Actin II)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_ONCVO (P30163) Actin-2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_LYTPI (P53466) Actin, cytoskeletal 2 (LPC2)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_LUMTE (P92176) Actin-2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_DROME (P02572) Actin-42A|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT2_CAEEL (P10984) Actin-2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_STRFN (P10990) Actin-15A|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_SACKO (O18499) Actin-1|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_PODCA (P41112) Actin-1/2|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_PLAYO (Q7RME1) Actin-1 (Actin I)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_PLAFA (P10988) Actin-1 (Actin I)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_PLAF7 (Q8I4X0) Actin-1 (Actin I)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_PHYIN (P22131) Actin-1|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_ONCVO (P30162) Actin-1|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_LYTPI (P53465) Actin, cytoskeletal 1 (LPC1)|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_LUMTE (P92182) Actin-1|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_HELTB (P69003) Actin CyI, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_HELER (P69002) Actin CyI, cytoplasmic|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_DROME (P10987) Actin-5C|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT1_CAEEL (P10983) Actin-1/3|
          Length = 376

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 366 SGPSIVHRKCF 376
to top
>ACT12_SOLTU (P30172) Actin-100 (Fragment)|
          Length = 357

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 347 SGPSIVHRKCF 357
to top
>ACT_PINCO (P24902) Actin (Fragment)|
          Length = 161

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 151 SGPSIVHRKCF 161
to top
>ACT3_ARTSX (P18602) Actin, clone 302 (Fragment)|
          Length = 327

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 317 SGPSIVHRKCF 327
to top
>ACT6_DIPDE (P53459) Actin-6 (Fragment)|
          Length = 373

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 363 SGPSIVHRKCF 373
to top
>ACTM_LYTPI (Q25381) Actin, muscle (LPM) (Fragment)|
          Length = 172

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 162 SGPSIVHRKCF 172
to top
>ACT3_LYTPI (Q25379) Actin, cytoskeletal 3 (LPC3) (Fragment)|
          Length = 172

 Score = 28.5 bits (62), Expect = 4.2
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVHRKCF
Sbjct: 162 SGPSIVHRKCF 172
to top
>KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing protein 7|
          Length = 684

 Score = 28.1 bits (61), Expect = 5.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = -3

Query: 217 PVTVFSYSKTVISIATCACPS*FWTHEFGLFNQI*SDAW 101
           P+T F+++KTV S A C  P     H+  L  Q   D W
Sbjct: 372 PLTSFAHTKTVTSSAVCVSPD----HDIYLAAQPRKDLW 406
to top
>UFOG_SOLME (Q43641) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)|
           (Flavonol 3-O-glucosyltransferase) (UDP-glucose
           flavonoid 3-O-glucosyltransferase)
          Length = 433

 Score = 27.7 bits (60), Expect = 7.1
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = -2

Query: 317 ESQEEPLSRPSCRFASLFCCCFFVSVDKVFGWPTGYRFLLFKDCNIYCYLCLSLV 153
           E++EE   + SC F+  F  CF V + K    P G  +     C++  +L   L+
Sbjct: 99  EAEEETGVKFSCIFSDAFLWCFLVKLPKKMNAP-GVAYWTGGSCSLAVHLYTDLI 152
to top
>ACT_PHARH (P53689) Actin|
          Length = 375

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 365 AGPSIVHRKCF 375
to top
>ACTN_STYCL (P53475) Actin, muscle|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACTM_STYCL (P26198) Actin, muscle|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACTM_MOLOC (P53467) Actin, larval muscle-type (A1)|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACTM_CIOSA (O15998) Actin, muscle|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACT2_HALRO (P27130) Actin, muscle 2/4/4A|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACT1_HALRO (P53460) Actin, muscle 1A|
          Length = 378

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 368 AGPSIVHRKCF 378
to top
>ACTT_FUGRU (P53482) Actin, alpha skeletal muscle 2|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_RAT (P68136) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_RABIT (P68135) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_PIG (P68137) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_OREMO (P68264) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_MOUSE (P68134) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_HUMAN (P68133) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_FUGRU (P68140) Actin, alpha skeletal muscle 1|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_CYPCA (P53479) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_CHICK (P68139) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_CARAU (P49055) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_BOVIN (P68138) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTS_ATRMM (Q90X97) Actin, alpha skeletal muscle (Alpha-actin-1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTC_RAT (P68035) Actin, alpha cardiac (Alpha-cardiac actin)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTC_MOUSE (P68033) Actin, alpha cardiac (Alpha-cardiac actin)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTC_HUMAN (P68032) Actin, alpha cardiac (Alpha-cardiac actin)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTC_FUGRU (P53480) Actin, alpha cardiac|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTC_CHICK (P68034) Actin, alpha cardiac (Alpha-cardiac actin)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_RAT (P62738) Actin, aortic smooth muscle (Alpha-actin-2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_RABIT (P62740) Actin, aortic smooth muscle (Alpha-actin-2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_MOUSE (P62737) Actin, aortic smooth muscle (Alpha-actin-2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_HUMAN (P62736) Actin, aortic smooth muscle (Alpha-actin-2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_CHICK (P08023) Actin, aortic smooth muscle (Alpha-actin)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACTA_BOVIN (P62739) Actin, aortic smooth muscle (Alpha-actin-2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT3_XENLA (P04752) Actin, alpha sarcomeric/skeletal (Actin alpha 3)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT3_DIPDE (P53457) Actin-3|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGP+IVHRKCF
Sbjct: 367 SGPAIVHRKCF 377
to top
>ACT2_XENTR (P20399) Actin, alpha sarcomeric/cardiac (Actin alpha 2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT2_XENLA (P10995) Actin, alpha sarcomeric/cardiac (Actin alpha 2)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT2_ORYSA (P17298) Actin-2|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGP+IVHRKCF
Sbjct: 367 SGPAIVHRKCF 377
to top
>ACT1_XENLA (P04751) Actin, alpha cardiac muscle (Actin alpha 1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT1_SOYBN (P02581) Actin-1|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGPSIVH+KCF
Sbjct: 367 SGPSIVHKKCF 377
to top
>ACT1_ORYLA (Q98972) Actin, muscle-type (OlMA1)|
          Length = 377

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 367 AGPSIVHRKCF 377
to top
>ACT_ENTHI (P11426) Actin|
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGP+IVHRKCF
Sbjct: 366 SGPAIVHRKCF 376
to top
>ACTH_RAT (P63269) Actin, gamma-enteric smooth muscle (Smooth muscle gamma|
           actin) (Alpha-actin-3)
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 366 AGPSIVHRKCF 376
to top
>ACTH_MOUSE (P63268) Actin, gamma-enteric smooth muscle (Smooth muscle gamma|
           actin) (Alpha-actin-3)
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 366 AGPSIVHRKCF 376
to top
>ACTH_HUMAN (P63267) Actin, gamma-enteric smooth muscle (Smooth muscle gamma|
           actin) (Alpha-actin-3)
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 366 AGPSIVHRKCF 376
to top
>ACTH_CHICK (P63270) Actin, gamma-enteric smooth muscle (Smooth muscle gamma|
           actin) (Alpha-actin-3)
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 366 AGPSIVHRKCF 376
to top
>ACT1_AEDAE (P49128) Actin-1|
          Length = 376

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           SGP+IVHRKCF
Sbjct: 366 SGPAIVHRKCF 376
to top
>ACTS_PLEWA (P10994) Actin, alpha skeletal muscle (Fragment)|
          Length = 125

 Score = 27.3 bits (59), Expect = 9.3
 Identities = 10/11 (90%), Positives = 11/11 (100%)
 Frame = -2

Query: 371 SGPSIVHRKCF 339
           +GPSIVHRKCF
Sbjct: 115 AGPSIVHRKCF 125


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,555,341
Number of Sequences: 219361
Number of extensions: 729052
Number of successful extensions: 1532
Number of sequences better than 10.0: 211
Number of HSP's better than 10.0 without gapping: 1523
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1532
length of database: 80,573,946
effective HSP length: 99
effective length of database: 58,857,207
effective search space used: 1412572968
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
to top