Clone Name | rbart61e01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y5621_ARATH (O81488) PHD finger protein At5g26210 | 37 | 0.012 | 2 | SWR1_NEUCR (Q7S133) Helicase swr-1 (EC 3.6.1.-) | 28 | 7.0 | 3 | YQAT_BACSU (P45916) Hypothetical protein yqaT (ORF50) | 28 | 7.0 |
---|
>Y5621_ARATH (O81488) PHD finger protein At5g26210| Length = 255 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -3 Query: 376 KAESIKQYKCPSCSSKRPR 320 +AE IKQYKCPSCS+KR R Sbjct: 236 RAEHIKQYKCPSCSNKRAR 254
>SWR1_NEUCR (Q7S133) Helicase swr-1 (EC 3.6.1.-)| Length = 1845 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 41 KSYTYFHHSTIPSRQHTPLTPLQDMEMLEGFENVCHLPLTSIS 169 KSY+ HH +P+ +T T D E GF + PL+SIS Sbjct: 64 KSYSSTHH--VPAIDNTSTTNANDNEDAAGFLDRDQSPLSSIS 104
>YQAT_BACSU (P45916) Hypothetical protein yqaT (ORF50)| Length = 431 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 17 LLEHELPMKSYTYFHHSTIPSRQHTPLTPLQDMEMLEGFE 136 L E + + + TY+HHST P + +Q +E L+ ++ Sbjct: 180 LYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYD 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,920,102 Number of Sequences: 219361 Number of extensions: 825296 Number of successful extensions: 1822 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1822 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)