Clone Name | rbart61d11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CDAN1_HUMAN (Q8IWY9) Codanin-1 | 30 | 1.8 | 2 | AOC3_ARATH (Q9LS01) Allene oxide cyclase 3, chloroplast precurso... | 28 | 5.1 | 3 | AOC4_ARATH (Q93ZC5) Allene oxide cyclase 4, chloroplast precurso... | 28 | 6.7 |
---|
>CDAN1_HUMAN (Q8IWY9) Codanin-1| Length = 1226 Score = 30.0 bits (66), Expect = 1.8 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -2 Query: 188 LPQGHPGPAK----GAALHARPAFPHRGANARR 102 LPQG P PAK AAL RP P RG+ R Sbjct: 65 LPQGPPTPAKTPGASAALPGRPGGPPRGSRGAR 97
>AOC3_ARATH (Q9LS01) Allene oxide cyclase 3, chloroplast precursor (EC| 5.3.99.6) Length = 258 Score = 28.5 bits (62), Expect = 5.1 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 187 YLKGIP-DLPKELLCXXXXXXXXXXXXPAAKATEPHACLNNFTD 59 YLKG+ DLP EL P AKA EP ++NFT+ Sbjct: 215 YLKGLANDLPLELTGTAVTPSKDVKPAPEAKAMEPSGVISNFTN 258
>AOC4_ARATH (Q93ZC5) Allene oxide cyclase 4, chloroplast precursor (EC| 5.3.99.6) Length = 254 Score = 28.1 bits (61), Expect = 6.7 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 187 YLKGIP-DLPKELLCXXXXXXXXXXXXPAAKATEPHACLNNFTD 59 YLKG+ DLP EL A+AT+P A + NFT+ Sbjct: 211 YLKGVAADLPVELTGKHVEPSKEVKPAAEAQATQPGATIANFTN 254 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,364,678 Number of Sequences: 219361 Number of extensions: 211465 Number of successful extensions: 567 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)