| Clone Name | rbart61d10 |
|---|---|
| Clone Library Name | barley_pub |
>FA12_HUMAN (P00748) Coagulation factor XII precursor (EC 3.4.21.38) (Hageman| factor) (HAF) [Contains: Coagulation factor XIIa heavy chain; Beta-factor XIIa part 1; Beta-factor XIIa part 2; Coagulation factor XIIa light chain] Length = 615 Score = 28.1 bits (61), Expect = 5.8 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Frame = +3 Query: 138 FSPKHLPFFYKKENKNSSQAAAVAVCLCTSVYV-CQ----PAMNTRLCLTAG 278 F P+ L FF+K E ++ AAVA C C CQ A T CL G Sbjct: 136 FEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGG 187
>MTFA_PASMU (Q9CN71) Putative RNA 2'-O-ribose methyltransferase mtfA (EC| 2.1.1.-) Length = 365 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 142 EKKCKISQQKYVHNFGSCKDGWLKQL 65 E+K ++++Q Y + G+C GW QL Sbjct: 210 EEKKRLNEQMYAVDLGACPGGWTYQL 235
>MATK_VERRI (Q7YKL5) Maturase K (Intron maturase)| Length = 508 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 186 SFYFPFYKRMVSALEKKNAKFPN 118 S PF +R++S LEKK KF N Sbjct: 101 SVEIPFSRRLISCLEKKIVKFQN 123
>SC6A6_BOVIN (Q9MZ34) Sodium- and chloride-dependent taurine transporter| Length = 620 Score = 27.7 bits (60), Expect = 7.5 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 10/70 (14%) Frame = +3 Query: 114 FCWEILH---------FFSPKHLPFFYKKENKNSSQAAAVAVCLCTSVYVCQP-AMNTRL 263 +CW ++ F K++P Y K + A + CL S VC P M RL Sbjct: 506 YCWAVVTPLLCTGCFIFSLVKYVPLTYNKVYTYPTWAIGLGWCLALSSMVCVPLVMVIRL 565 Query: 264 CLTAGEEQIR 293 T G +R Sbjct: 566 AQTEGPFLVR 575
>LYST_MOUSE (P97412) Lysosomal trafficking regulator (Beige protein) (CHS1| homolog) Length = 3788 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 151 CFGEKKCKISQQKYVHNFGSCKDGWLKQL 65 C G K +S+Q++ GSCK+ QL Sbjct: 2703 CIGSSKTSVSKQQWTKILGSCKETLRDQL 2731 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,476,432 Number of Sequences: 219361 Number of extensions: 845401 Number of successful extensions: 1953 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1952 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)