Clone Name | rbart61d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.... | 28 | 4.4 |
---|
>ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel1) (Telomere length regulation protein 1) (ATM homolog) Length = 2925 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -2 Query: 203 HRSIDHRAHALLLSLPNTIHPFGYISCWEXXXXXXXXXXXXXLSSSVRA 57 H S+D ++ LL LPN + G ++ W S S+RA Sbjct: 458 HASVDSKSSLLLRLLPNILDENGILASWTMITIASLAGSPNADSPSLRA 506 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,172,622 Number of Sequences: 219361 Number of extensions: 804946 Number of successful extensions: 1550 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)