Clone Name | rbart61c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CER1_HUMAN (O95813) Cerberus precursor (Cerberus-related protein) | 32 | 0.39 | 2 | MATK_DROLU (Q5J2U8) Maturase K (Intron maturase) | 29 | 2.5 | 3 | YR224_MIMIV (Q5UQB7) Putative BTB/POZ domain-containing protein ... | 28 | 4.3 | 4 | GAOX1_ORYSA (P93771) Gibberellin 20 oxidase 1 (EC 1.14.11.-) (Gi... | 28 | 4.3 |
---|
>CER1_HUMAN (O95813) Cerberus precursor (Cerberus-related protein)| Length = 267 Score = 32.0 bits (71), Expect = 0.39 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -2 Query: 339 FNPGSDAMVEPLEEMVSDERPARYDAYNWGHFFSTRK 229 F PG+ ++++P++ M ++ P R +A + H F RK Sbjct: 105 FPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRK 141
>MATK_DROLU (Q5J2U8) Maturase K (Intron maturase)| Length = 514 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 270 YDAYNWGHFFSTRKNSNFKK 211 Y+++NW FFS +KN +F K Sbjct: 183 YESHNWNSFFSLKKNISFLK 202
>YR224_MIMIV (Q5UQB7) Putative BTB/POZ domain-containing protein R224| Length = 540 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 142 ESAKIHSKVELSEVCDLYVFDV 207 E + IH+K+ VCD+YV+D+ Sbjct: 206 EFSSIHNKIIYHHVCDIYVYDL 227
>GAOX1_ORYSA (P93771) Gibberellin 20 oxidase 1 (EC 1.14.11.-) (Gibberellin C-20| oxidase 1) (GA 20-oxidase 1) (Os20ox) Length = 372 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 333 PGSDAMVEPLEEMVSDERPARYDAYNW 253 P D +V P EE+V D P Y + W Sbjct: 309 PEMDTVVRPPEELVDDHHPRVYPDFTW 335 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,356,258 Number of Sequences: 219361 Number of extensions: 562000 Number of successful extensions: 1384 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1384 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)