Clone Name | rbart61c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ANG1_EMENI (Q00746) Antigen 1 precursor (ASPND1) | 29 | 3.2 | 2 | CN113_HUMAN (Q9NXV8) Protein C14orf113 | 28 | 5.5 | 3 | RRF_VIBVY (Q7MIG3) Ribosome recycling factor (Ribosome-releasing... | 28 | 7.1 | 4 | TNR22_MOUSE (Q9ER62) Tumor necrosis factor receptor superfamily ... | 28 | 7.1 |
---|
>ANG1_EMENI (Q00746) Antigen 1 precursor (ASPND1)| Length = 277 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = -2 Query: 107 NAKFDCWGGNWRGE----ENIICPTS 42 N + WGG+WRGE E +IC S Sbjct: 113 NCALEGWGGHWRGENASDETVICELS 138
>CN113_HUMAN (Q9NXV8) Protein C14orf113| Length = 159 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 1 RNNEGCIGASRIH*LVGQIIFSSPLQFPPQQ 93 RNN GC+ SR L +I + PLQF +Q Sbjct: 30 RNNNGCLPCSRCSELSVEITRTPPLQFEGKQ 60
>RRF_VIBVY (Q7MIG3) Ribosome recycling factor (Ribosome-releasing factor)| (RRF) Length = 185 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 81 PSPTVKLSITYFWFLRPLTQVASRVAKNAR 170 PS +S+ Y+ PLTQVA+ +A++AR Sbjct: 34 PSLLSGISVDYYGAATPLTQVANVIAEDAR 63
>TNR22_MOUSE (Q9ER62) Tumor necrosis factor receptor superfamily member 22| (Tumor necrosis factor receptor p60 homolog 2) (TNF receptor family member SOBa) (Decoy TRAIL receptor 2) (TNF receptor homolog 2) Length = 198 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -3 Query: 220 CWPSNNCVKHVMLMQSCRAFLATRLATCVSGLKNQKYVMLS 98 C P C + + ++Q C + T ++ VS +N+ +++LS Sbjct: 141 CRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNRLFLLLS 181 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,969,036 Number of Sequences: 219361 Number of extensions: 961596 Number of successful extensions: 2161 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2161 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)