Clone Name | rbart61c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | URE1_NOCFA (Q5YWR8) Urease alpha subunit (EC 3.5.1.5) (Urea amid... | 30 | 1.3 | 2 | STP2_YEAST (P38704) Zinc finger protein STP2 | 29 | 3.8 | 3 | URE11_STRCO (Q9FCD3) Urease alpha subunit 1 (EC 3.5.1.5) (Urea a... | 28 | 6.5 | 4 | URE1_AGRT5 (Q8UCT2) Urease alpha subunit (EC 3.5.1.5) (Urea amid... | 28 | 8.6 |
---|
>URE1_NOCFA (Q5YWR8) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 573 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 80 AHKKGHPADLSPTRPHT-SSKRGHCRSCLDCHCYHLSPS 193 AH P+ +PTRPHT ++ H + CH HLSPS Sbjct: 296 AHPNVLPSSTNPTRPHTVNTLDEHLDMLMVCH--HLSPS 332
>STP2_YEAST (P38704) Zinc finger protein STP2| Length = 541 Score = 28.9 bits (63), Expect = 3.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -2 Query: 162 KQLRQCPLFDDVCGLVGDRSAGCPFLCAHCN 70 K + + PL D+V G+ + S P++C +C+ Sbjct: 180 KSIDESPLSDEVQGIADESSETLPYICHYCD 210
>URE11_STRCO (Q9FCD3) Urease alpha subunit 1 (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit 1) Length = 573 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 98 PADLSPTRPHT-SSKRGHCRSCLDCHCYHLSPS 193 PA +PTRPHT ++ H + CH HL+P+ Sbjct: 302 PASTNPTRPHTVNTVEEHLDMLMVCH--HLNPA 332
>URE1_AGRT5 (Q8UCT2) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 569 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 77 CAHKKGHPADLSPTRPHT-SSKRGHCRSCLDCHCYHLSPS 193 C + P+ +PTRP+T ++ H + CH HLSPS Sbjct: 289 CGNPNVIPSSTNPTRPYTVNTLAEHLDMLMVCH--HLSPS 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,664,395 Number of Sequences: 219361 Number of extensions: 546319 Number of successful extensions: 1815 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1814 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)