>ABS_DROME (Q9V3C0) ATP-dependent RNA helicase abstrakt (EC 3.6.1.-) (DEAD box|
           protein abstrakt)
          Length = 619

 Score = 27.7 bits (60), Expect = 8.2
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = -2

Query: 195 SDVLVPGARSPSVNSDTSSGKGDLRTYGRKREMWFLNPDHLDL 67
           S+   P + S + N D S G  D+ T+GRK  +  L+  H +L
Sbjct: 49  SETAQPKSSSENENEDDSQGAHDVETWGRKYNISLLD-QHTEL 90


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,786,074
Number of Sequences: 219361
Number of extensions: 579290
Number of successful extensions: 1273
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1250
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1273
length of database: 80,573,946
effective HSP length: 59
effective length of database: 67,631,647
effective search space used: 1623159528
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)