Clone Name | rbart61c06 |
---|---|
Clone Library Name | barley_pub |
>BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 precursor| Length = 1572 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 228 TMPATTPGSTTEAASISRSILRCSD 154 TMP T PGST + S+ R LR SD Sbjct: 1432 TMPRTVPGSTMKMGSLERKKLRYSD 1456
>AFRP_STRGR (Q9ZN78) A-factor receptor protein (A-factor-binding protein)| Length = 276 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 194 SVVEPGVVAGIVPTGRVGDHVADEEPAERASEQPR 298 S+ PGV+A I P GRV E AER ++ R Sbjct: 183 SIAHPGVIAHIKPEGRVDLAAQAREKAEREEQEAR 217
>CFTR_DIDMA (Q2QL74) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1482 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = -1 Query: 121 SLIFLQLFCLEIFLLKVAGASVG 53 +L+F+ ++CL IFL++VA + VG Sbjct: 859 NLVFVLIWCLVIFLVEVAASLVG 881
>HSLU_LACPL (Q88W26) ATP-dependent hsl protease ATP-binding subunit hslU| Length = 472 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 116 QGRTKELCCIGLKSEHRRIDLEIEAASVVEPGVVAGIVPTG 238 Q + K+ I L++ +RR++L E + P + I PTG Sbjct: 22 QNQAKKAVAIALRNRYRRMELSAEMQEEITPKNMLMIGPTG 62
>CFTR_TRIVU (Q5D1Z7) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1478 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -1 Query: 121 SLIFLQLFCLEIFLLKVAGASVG 53 SLIF+ ++CL IFL++V + VG Sbjct: 860 SLIFVLIWCLVIFLVEVGASLVG 882
>RS3_METAC (Q8TRU1) 30S ribosomal protein S3P| Length = 318 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +2 Query: 197 VVEPGVVAGIVPTGRVGDHVADEEPAERASEQP 295 +++PGVV + + +V + V EEPAE+ +E+P Sbjct: 182 IIQPGVV--LPDSYKVRESVEVEEPAEKPAEKP 212
>HSLU_AZOSE (Q5P503) ATP-dependent hsl protease ATP-binding subunit hslU| Length = 442 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 116 QGRTKELCCIGLKSEHRRIDLEIEAASVVEPGVVAGIVPTG 238 QG+ K+ I L++ RR +E S + P + I PTG Sbjct: 20 QGKAKKAVAIALRNRWRRAQVEEPLRSEITPKNILMIGPTG 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,566,158 Number of Sequences: 219361 Number of extensions: 524811 Number of successful extensions: 1754 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1746 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)