Clone Name | rbart61c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRUD1_METJA (Q58008) Probable tRNA pseudouridine synthase D 1 (E... | 28 | 8.8 | 2 | PRKDC_CHICK (Q8QGX4) DNA-dependent protein kinase catalytic subu... | 28 | 8.8 |
---|
>TRUD1_METJA (Q58008) Probable tRNA pseudouridine synthase D 1 (EC 5.4.99.-)| (tRNA-uridine isomerase D 1) (tRNA pseudouridylate synthase D 1) Length = 392 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 36 QSTFTLLPPFLNISFCRDFTSGLHTDVYRHTLEYIF 143 Q F +LPP+L F + S L ++ EY F Sbjct: 255 QKAFMILPPYLRCMFINAYQSYLFNEIINRRFEYGF 290
>PRKDC_CHICK (Q8QGX4) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4134 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -3 Query: 379 DVMKEMEEGWGDLPTVPRKLVFKAFMLAGRPM*RDD----ELLGVVNCDQ*PLFSL 224 +++K + E W + ++P L+F+ F +G P +D+ +LLG+V + P F L Sbjct: 2235 EIIKTVIECWKNCLSIPYSLIFEKFS-SGDPDTKDNSVGIQLLGIVLANNLPPFDL 2289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,799,693 Number of Sequences: 219361 Number of extensions: 905831 Number of successful extensions: 2022 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2020 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)