ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart61b09 |
|---|---|
| Clone Library Name | barley_pub |
>TMSP8_RAT (P83748) Transmembrane serine protease 8 precursor (EC 3.4.21.-)| (Distal intestinal serine protease) (Transmembrane serine protease 1) (TMSP-1) Length = 304 Score = 31.6 bits (70), Expect = 0.50 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 204 VMHFHWVHNGCHCLRRPWGSGYNHLQLG 287 ++H WV HC RRP S + H+++G Sbjct: 61 LIHEVWVLTAAHCFRRPLNSSFYHVKVG 88
>RAD52_EMENI (Q96UP6) DNA repair and recombination protein radC (RAD52 homolog)| Length = 582 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 342 APRENSRSPMKADSPNNMSPAANGCSPSP 256 AP N + P D N P NGC+P+P Sbjct: 529 APNMNGKRPPLNDVTNETLPGGNGCTPAP 557
>SLBP_DROME (Q9VAN6) Histone RNA hairpin-binding protein (Histone| stem-loop-binding protein) Length = 276 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -1 Query: 354 SRSPAPRENSRSPMKADSPNNMSPAANGCSPSPRDGED 241 S +P ENSRS +SPN+ + +ANG + +P+ G + Sbjct: 118 SFTPPSNENSRS----NSPNSSNSSANGDAAAPKGGNN 151
>ODO1_YEAST (P20967) 2-oxoglutarate dehydrogenase E1 component, mitochondrial| precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) Length = 1014 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 22 GVSNTEIEYTIKSNSYRQVFVQDFGEFCNCRKNLIDSRLSPGDALPLGEHWK 177 GV E Y++ S Y ++ FG+F N + +ID ++ G+ + WK Sbjct: 718 GVMGFEYGYSLTSPDYLVMWEAQFGDFANTAQVIIDQFIAGGE-----QKWK 764
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -1 Query: 354 SRSPAPRENSRSPMKAD---SPNNMSPAANGCSPSP 256 +RSP+PR S SP D SP +P+ PSP Sbjct: 17 TRSPSPRTQSPSPRDEDGSRSPGERTPSPPSRDPSP 52
>SSPA_STAAU (P04188) Glutamyl endopeptidase precursor (EC 3.4.21.19)| (Staphylococcal serine proteinase) (V8 protease) (V8 proteinase) (Endoproteinase Glu-C) Length = 336 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 345 PAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNGNH 229 P +N +P D+PNN N +P+ D DNG++ Sbjct: 289 PNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDN 327
>SFRS1_ARATH (O22315) Pre-mRNA-splicing factor SF2 (SR1 protein)| Length = 303 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -1 Query: 354 SRSPAPRENSRSPMKADSPNNMSPAANGCSPSPR 253 SRSP + + RSP K+ S + P + SPSPR Sbjct: 233 SRSPKAKSSRRSPAKSTS-RSPGPRSKSRSPSPR 265
>PZRN4_HUMAN (Q6ZMN7) PDZ domain-containing RING finger protein 4 (Ligand of| Numb-protein X 4) (SEMACAP3-like protein) Length = 1036 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 345 PAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNG 235 PA R SR + PA GC P+PR G G Sbjct: 108 PARRLRSRGGCASGLGGGEVPARGGCGPTPRAGRGGG 144
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 345 PAPRENSRSPMKADSPNNMSPAANGCSPSPRD 250 P P E+ SP +SP + P A+ SP P + Sbjct: 442 PPPEESPLSPPPEESPTSPPPEASRLSPPPEE 473
>SSPA_STAAN (Q7A6A6) Glutamyl endopeptidase precursor (EC 3.4.21.19)| (Staphylococcal serine proteinase) (V8 protease) (V8 proteinase) (Endoproteinase Glu-C) Length = 342 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 348 SPAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNGNH 229 +P N +P D+PNN N +P+ D DNG++ Sbjct: 294 NPDNPNNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDN 333
>SSPA_STAAM (Q99V45) Glutamyl endopeptidase precursor (EC 3.4.21.19)| (Staphylococcal serine proteinase) (V8 protease) (V8 proteinase) (Endoproteinase Glu-C) Length = 342 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 348 SPAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNGNH 229 +P N +P D+PNN N +P+ D DNG++ Sbjct: 294 NPDNPNNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGDN 333
>CUTL1_HUMAN (P39880) Homeobox protein cut-like 1 (CCAAT displacement protein)| (CDP) Length = 1505 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 327 SRSPMKADSPNNMSPAANGCSPSPRDGEDNGN 232 S + + + SP SP NG +PSP E G+ Sbjct: 513 STNSISSQSPLQQSPDVNGMAPSPSQSESAGS 544
>SOX8_CHICK (P57074) Transcription factor SOX-8| Length = 470 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -1 Query: 348 SPAPRENSRSPMKADSPNNMSPAAN---GCSPSP 256 SPA +S S + +DS + +SPA + GC+P+P Sbjct: 17 SPAGTTSSMSHVDSDSDSPLSPAGSEGLGCAPAP 50
>MTG8_HUMAN (Q06455) Protein CBFA2T1 (Protein MTG8) (Protein ETO) (Eigth twenty| one protein) (Cyclin D-related protein) (Zinc finger MYND domain-containing protein 2) Length = 604 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 342 APRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNG 235 APR +S +P + + SP A +PSP +G NG Sbjct: 65 APRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNG 100
>MTG8_MOUSE (Q61909) Protein CBFA2T1 (MTG8 protein)| Length = 577 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 342 APRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNG 235 APR +S +P + + SP A +PSP +G NG Sbjct: 38 APRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNG 73
>SSPA_STAAC (Q5HH35) Glutamyl endopeptidase precursor (EC 3.4.21.19)| (Staphylococcal serine proteinase) (V8 protease) (V8 proteinase) (Endoproteinase Glu-C) Length = 336 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 345 PAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNGN 232 P +N +P D+PNN N +P+ D DNG+ Sbjct: 289 PNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPDNPDNGD 326
>RPOB_MYCGA (P47715) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1390 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = +1 Query: 28 SNTEIEYTIKSNSYRQVFVQDFGEFCNCRKNLIDSRLSPGDALPLGEHWKNLI 186 +N I +++S Y + + + + +++ R+S +LP+ + WKNL+ Sbjct: 239 NNDYILRSLESEFYNEKQILNEADIAQLIRDIESDRISKVKSLPIDQKWKNLV 291
>CUTL1_MOUSE (P53564) Homeobox protein cut-like 1 (CCAAT displacement protein)| (CDP) (Homeobox protein Cux) Length = 1515 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 327 SRSPMKADSPNNMSPAANGCSPSPRDGEDNGN 232 S + + + SP SP NG +PSP E G+ Sbjct: 511 STNSISSPSPLQQSPDVNGMAPSPSQSESAGS 542
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -1 Query: 351 RSPAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNGN 232 RSP+P SRSP + SP S SP D D N Sbjct: 279 RSPSPPRGSRSPSEKGSPRRSR------SASPMDNGDGDN 312
>TRI37_MOUSE (Q6PCX9) Tripartite motif protein 37| Length = 961 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 354 SRSPAPRENSRSPMKADSPNNMSPAANGCSPSPRDG 247 SR +P +N SP DSP + A CS +G Sbjct: 450 SRDLSPPDNHLSPQNDDSPETRTKKAGSCSDMLLEG 485
>TCF17_MOUSE (Q61751) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 572 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +3 Query: 15 SDWSIKYRNRVHDKIKLVQASLCSRFWRVL*L*EKFDRLSTLTR--GCTPTG*TLEKFDP 188 S S++Y R+H K + S C R + + +R+ T + C+ G Sbjct: 332 SSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCSECGKGFTSISR 391 Query: 189 LNHHRVMH 212 LN HR++H Sbjct: 392 LNRHRIIH 399
>TRI55_RAT (Q5PQN5) Tripartite motif-containing 63 (Muscle-specific RING| finger protein 2) (MuRF2) (MURF-2) (RING finger protein 29) Length = 545 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 121 NFSYSYKTLQNLEQRLACTSLILSCTLFRYLILQSDHNIC 2 +FS +T+ NLE++L C + L +IL HN+C Sbjct: 9 SFSKEQQTMDNLEKQLIC-PICLEMFTKPVVILPCQHNLC 47
>TRI55_HUMAN (Q9BYV6) Tripartite motif-containing 55 (Muscle-specific RING| finger protein 2) (MuRF2) (MURF-2) (RING finger protein 29) Length = 548 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 121 NFSYSYKTLQNLEQRLACTSLILSCTLFRYLILQSDHNIC 2 +FS +T+ NLE++L C + L +IL HN+C Sbjct: 9 SFSKEQQTMDNLEKQLIC-PICLEMFTKPVVILPCQHNLC 47
>TCF17_HUMAN (O60765) Zinc finger protein 354A (Transcription factor 17) (Zinc| finger protein eZNF) Length = 605 Score = 27.3 bits (59), Expect = 9.5 Identities = 19/77 (24%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Frame = +3 Query: 15 SDWSIKYRNRVHDKIKLVQASLCSRFWRVL*L*EKFDRLSTLTR--GCTPTG*TLEKFDP 188 S S++Y R+H K + S C R + + +R+ T + C G Sbjct: 365 SSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFTSISR 424 Query: 189 LNHHRVMHFHWVHNGCH 239 LN HR++H + C+ Sbjct: 425 LNRHRIIHTGEKYYNCN 441
>YKF1_YEAST (P35735) Hypothetical 40.5 kDa protein in NUP120-CSE4 intergenic| region Length = 353 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 208 ITRWWLSGSNFSSVHPVGVHPLVRVESRSNFSYSYKTLQNL 86 I ++L G +++SVHP+ S +F+ Y T+ L Sbjct: 179 IAEYFLMGRHYASVHPLASPHFNPQSSEKSFNQDYNTVDEL 219
>CNOT3_MOUSE (Q8K0V4) CCR4-NOT transcription complex subunit 3 (CCR4-associated| factor 3) Length = 751 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -1 Query: 354 SRSPAPRENSRSPMKADSPNNMSPAANGCSPSPRDGEDNG 235 S +PAP + +P A P+N P PS G +G Sbjct: 365 SGTPAPYAQAVAPPNASGPSNAQPRPPSAQPSGGSGGGSG 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,301,447 Number of Sequences: 219361 Number of extensions: 1031922 Number of successful extensions: 3118 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 2975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3115 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
