ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart60h08 |
|---|---|
| Clone Library Name | barley_pub |
>MIOX4_ARATH (Q8H1S0) Inositol oxygenase 4 (EC 1.13.99.1) (Myo-inositol| oxygenase 4) (AtMIOX4) Length = 317 Score = 77.0 bits (188), Expect = 1e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 353 HVFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 HVFNKYDLYSKS V +DVEKVKPYYMSLI+KYFPE L+W Sbjct: 279 HVFNKYDLYSKSKVHVDVEKVKPYYMSLIKKYFPENLRW 317
>MIOX_ORYSA (Q5Z8T3) Probable inositol oxygenase (EC 1.13.99.1) (Myo-inositol| oxygenase) Length = 308 Score = 75.5 bits (184), Expect = 3e-14 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 350 VFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 VFNKYDLYSKS+ RIDVEKVKPYYMSLIEKYFP KL+W Sbjct: 271 VFNKYDLYSKSNERIDVEKVKPYYMSLIEKYFPAKLRW 308
>MIOX5_ARATH (Q9FJU4) Inositol oxygenase 5 (EC 1.13.99.1) (Myo-inositol| oxygenase 5) (AtMIOX5) Length = 314 Score = 75.1 bits (183), Expect = 4e-14 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 353 HVFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 HVFNKYDLYSKS V ++VEKVKPYYMSLI+KYFPE L+W Sbjct: 276 HVFNKYDLYSKSKVHVNVEKVKPYYMSLIKKYFPENLRW 314
>MIOX2_ARATH (O82200) Inositol oxygenase 2 (EC 1.13.99.1) (Myo-inositol| oxygenase 2) (AtMIOX2) Length = 317 Score = 73.6 bits (179), Expect = 1e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 353 HVFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 HVFNKYDLYSKS V +DVE+VKPYY+SLI KYFP KLKW Sbjct: 279 HVFNKYDLYSKSKVLVDVEQVKPYYISLINKYFPAKLKW 317
>MIOX1_ARATH (Q8L799) Inositol oxygenase 1 (EC 1.13.99.1) (Myo-inositol| oxygenase 1) (AtMIOX1) Length = 311 Score = 70.1 bits (170), Expect = 1e-12 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 350 VFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 VFNKYDLYSKS VR++VE+VKPYY+SL KYFP KLKW Sbjct: 274 VFNKYDLYSKSKVRVNVEEVKPYYLSLTNKYFPSKLKW 311
>MIOX_BRARE (Q4V8T0) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| Length = 278 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+KS+ DVE++KPYY SLI+KY P L+W Sbjct: 242 FNKFDLYTKSTELPDVERLKPYYQSLIDKYCPGVLQW 278
>MIOX_PIG (Q8WN98) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| (Aldehyde reductase-like 6) Length = 282 Score = 47.8 bits (112), Expect = 7e-06 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+K S DV++++PYY LI+KY P L W Sbjct: 246 FNKFDLYTKGSDMPDVDELRPYYQGLIDKYCPGVLCW 282
>MIOX_PONPY (Q5REY9) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| Length = 285 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+K DV+K++PYY LI+KY P L W Sbjct: 249 FNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW 285
>MIOX_MOUSE (Q9QXN5) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| (Aldehyde reductase-like 6) (Renal-specific oxidoreductase) Length = 285 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+K DVE ++PYY LI+KY P L W Sbjct: 249 FNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW 285
>MIOX_HUMAN (Q9UGB7) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| (Aldehyde reductase-like 6) (Renal-specific oxidoreductase) (Kidney-specific protein 32) Length = 285 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+K DV+K++PYY LI+KY P L W Sbjct: 249 FNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW 285
>MIOX_RAT (Q9QXN4) Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase)| (Aldehyde reductase-like 6) (Renal-specific oxidoreductase) (Kidney-specific protein 32) Length = 285 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -2 Query: 347 FNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPEKLKW 237 FNK+DLY+K +V+ ++PYY LI+KY P L W Sbjct: 249 FNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW 285
>CAC1A_MOUSE (P97445) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2164 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 114 VTIHDSLE---QSLFLLFSMASGSWNNNTIICCLGSVPC 221 +T H++ Q+L LLF A+G +N ++ CL PC Sbjct: 1636 ITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPC 1674
>CAC1A_HUMAN (O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2505 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 114 VTIHDSLE---QSLFLLFSMASGSWNNNTIICCLGSVPC 221 +T H++ Q+L LLF A+G +N ++ CL PC Sbjct: 1733 ITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPC 1771
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 114 VTIHDSLE---QSLFLLFSMASGSWNNNTIICCLGSVPC 221 +T H++ Q+L LLF A+G +N ++ CL PC Sbjct: 1742 ITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPC 1780
>CAC1A_RAT (P54282) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium channel I) (BI) (RAT brain class A) (RBA-I) Length = 2212 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 114 VTIHDSLE---QSLFLLFSMASGSWNNNTIICCLGSVPC 221 +T H++ Q+L LLF A+G +N ++ CL PC Sbjct: 1684 ITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPC 1722
>SPB1_CRYNE (Q5KM86) AdoMet-dependent rRNA methyltransferase SPB1 (EC 2.1.1.-)| (2'-O-ribose RNA methyltransferase) (S-adenosyl-L-methionine-dependent methyltransferase) Length = 908 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 353 HVFNKYDLYSKSSVRIDVEKVKPYYMSLIEKYFPE 249 H+ KYDL SK+ ID+ ++ + EKY P+ Sbjct: 35 HLNRKYDLLSKARCCIDLCAAPGGWLQVAEKYMPK 69
>POL_SOCMV (P15629) Enzymatic polyprotein [Contains: Aspartic protease (EC| 3.4.23.-); Endonuclease; Reverse transcriptase (EC 2.7.7.49)] Length = 692 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +2 Query: 71 TGVDTTSNAHSTRMSDNTRQLGTISFPSVFHGEWKLE**YYHMLFGFRSLP 223 + +D S + R+ +NT+ L S P H EW + + FG + P Sbjct: 294 SSLDAKSGYYQLRLHENTKPLTAFSCPPQKHYEWNV------LSFGLKQAP 338
>SECY_PEA (Q9XQU4) Preprotein translocase secY subunit, chloroplast precursor| (CpSecY) Length = 527 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 135 EQSLFLLFSMASGSWNNNTIICCLGSVPCLGASSPFQLLREV 260 + SL SG IC LG VP + A FQLL +V Sbjct: 152 QNSLLTTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQV 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,167,111 Number of Sequences: 219361 Number of extensions: 684199 Number of successful extensions: 1834 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1834 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
