Clone Name | rbart60h06 |
---|---|
Clone Library Name | barley_pub |
>SECY_CYAPA (P25014) Preprotein translocase secY subunit| Length = 492 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 3 KNNAANIVESYAGYGLLHLAFVTKKIIPQLKATKFL 110 +N ANI+ +G L + F T I+P + A+ FL Sbjct: 90 RNELANILNLLSGGAFLEIGFFTLGILPYMNASFFL 125
>POLG_EC09B (Q66577) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2202 Score = 28.1 bits (61), Expect = 6.3 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = +1 Query: 22 SSSHMQGTDCYILRXXXXXXXXXXXQQNFYVTTSGSTTTELALFAPT---YSAWSTSIAS 192 +S+HM+GTD + ++ +F + ST L Y+ WS SI Sbjct: 387 TSTHMEGTDAFQIKVTAGNVQDKSAIFSFQLNPGNSTVLRRTLLGEILNYYAHWSGSI-- 444 Query: 193 MESVSISFNFCPLSFA 240 ++F FC + A Sbjct: 445 ----KLTFLFCGSAMA 456
>MBB1A_RAT (O35821) Myb-binding protein 1A (PAR-interacting protein) (PIP)| Length = 1344 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 21 IVESYAGYGLLHLAFVTKKIIPQLKATK 104 +VE A + L H F TKK PQ+ TK Sbjct: 469 VVEQIARFCLFHAFFKTKKATPQIPETK 496
>MBB1A_MOUSE (Q7TPV4) Myb-binding protein 1A (Myb-binding protein of 160 kDa)| Length = 1344 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 21 IVESYAGYGLLHLAFVTKKIIPQLKATK 104 +VE A + L H F TKK PQ+ TK Sbjct: 469 VVEQIARFCLFHAFFKTKKATPQIPETK 496
>POLG_EC09H (Q66849) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = +1 Query: 22 SSSHMQGTDCYILRXXXXXXXXXXXQQNFYVTTSGSTTTELALFAPT---YSAWSTSIAS 192 +S+HM+GTD + ++ +F + ST L Y+ WS SI Sbjct: 387 TSTHMEGTDAFQIKVTAGNVQDKNAIFSFQLNPGNSTVLRRTLLGEILNYYAHWSGSI-- 444 Query: 193 MESVSISFNFCPLSFA 240 ++F FC + A Sbjct: 445 ----KLTFLFCGSAMA 456
>AMY1_LIPKO (Q01117) Alpha-amylase 1 precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase 1) Length = 624 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +1 Query: 106 FYVTTSGSTTTELALFAPTYS----AWSTSIASMESVSIS 213 +Y+T+SG+T + LAL P +S W+ S + +V I+ Sbjct: 78 YYLTSSGTTGSTLALILPVWSNNWELWTLSAIAAGAVEIT 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,022,960 Number of Sequences: 219361 Number of extensions: 476186 Number of successful extensions: 1108 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1108 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)