| Clone Name | rbart60g06 |
|---|---|
| Clone Library Name | barley_pub |
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 Query: 187 VCIFQCCLRY*CGALLHCTYPKCANVSTCGSLSFVSNACS 68 +C+ CC C C P C ++CGS S++C+ Sbjct: 60 ICVTSCCQPSCCST--PCCQPTCCGQTSCGSSCGQSSSCA 97
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = -1 Query: 214 CS*ASERACVCIFQCCLRY*CGAL---LHCTYPKCANVSTCGSLSFVSNAC 71 C + R C C CCLR CG + C P C +STC +++C Sbjct: 143 CESSCCRPCCCRPCCCLRPVCGRVSCHTTCYRPTCV-ISTCPRPLCCASSC 192
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = -1 Query: 214 CS*ASERACVCIFQCCLRY*CGAL---LHCTYPKCANVSTCGSLSFVSNAC 71 C + R C C CCLR CG + C P C +STC +++C Sbjct: 160 CESSCCRPCCCRPCCCLRPVCGRVSCHTTCYRPTCV-ISTCPRPLCCASSC 209
>YDM5_SCHPO (P87136) Hypothetical protein C57A7.05 in chromosome I| Length = 1337 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 236 CNYRSTVLFLSERASVCVYLSVLSTLLVWCTSSLHLPKMCKRQYLWF 96 C YR T F S + V++ + TL V CT +P C+ W+ Sbjct: 902 CGYRLTKFFKSIFRPMNVFVLKVGTLAVICT----IPAFCRSSAGWY 944
>YGL1_SCHPO (Q9Y7J8) Hypothetical protein C216.01c in chromosome II| Length = 836 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 6/37 (16%) Frame = -3 Query: 374 PLQEPRLV------YSISHGMDGILSRIVHQPSFVLI 282 P+Q+PR++ + + + D ++SRIV +PSF ++ Sbjct: 291 PIQDPRILAKIHQTFKLQYLRDVVVSRIVDEPSFSVL 327
>Y461_CHLTR (O84467) Hypothetical metallophosphoesterase CT_461 precursor (EC| 3.1.-.-) Length = 329 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 372 PSRAATSILNQPWNGWNPIAYCSSTIICADRC 277 P + +N+ GW I +CS IC RC Sbjct: 294 PEESRLLYVNRGLGGWKRIRFCSPPEICLMRC 325
>VACA3_HELPY (Q48253) Vacuolating cytotoxin precursor| Length = 1310 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = +1 Query: 115 LHILGRCSEEVHHTSNVDNTERYTHTLARSLKNSTVDR*LQEVPAMIQPRSNARATISTN 294 L+ + C + + S V+N E Y + ++ KN+ +++ + +N+ T ST Sbjct: 800 LNDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTNSTT 859 Query: 295 D 297 D Sbjct: 860 D 860
>MTH9_DROME (Q9W0R6) Probable G-protein coupled receptor Mth-like 9 precursor| (Protein methuselah-like 9) Length = 513 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = -1 Query: 235 VIIGLPYCS*ASERACVCIFQCCLRY*CGALL-------HCTYPKCANVSTCGSLSFVS 80 VI G+ Y + R CVC+ + C+ + C L +CT P ST L++ + Sbjct: 67 VIDGVEYRAKKHLRGCVCLLKPCISFCCPENLVFDAKHWNCTMPHQVRESTHVELTYAN 125
>HKT1_ARATH (Q84TI7) Sodium transporter HKT1 (AtHKT1)| Length = 506 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 242 TSCNYRSTVLFLSERASVCVYLSVLSTLLV 153 T +YR ++ + ERAS C+Y VLS LV Sbjct: 138 TVTDYREGLIKIDERASKCLYSVVLSYHLV 167
>ZN599_HUMAN (Q96NL3) Zinc finger protein 599| Length = 588 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 380 GHPLQEPRLVYSISHGMD 327 GHP+ +P L+Y + HG + Sbjct: 49 GHPVPKPELIYLLEHGQE 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,243,146 Number of Sequences: 219361 Number of extensions: 973456 Number of successful extensions: 2394 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2392 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)