| Clone Name | rbart60f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WRN_MOUSE (O09053) Werner syndrome ATP-dependent helicase homolo... | 31 | 0.91 | 2 | TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11 | 31 | 0.91 | 3 | QUEF_AQUAE (O67073) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-) | 28 | 5.9 | 4 | VG_DROME (Q26366) Protein vestigial | 28 | 5.9 | 5 | LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2... | 28 | 5.9 | 6 | ASPM_HYLLA (P62290) Abnormal spindle-like microcephaly-associate... | 28 | 7.7 |
|---|
>WRN_MOUSE (O09053) Werner syndrome ATP-dependent helicase homolog (EC 3.6.1.-)| Length = 1401 Score = 30.8 bits (68), Expect = 0.91 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 37 TRAHTHSLGEAHLQTVHTHTARTHLYRLVVHKASSSQGPRLSGITTVPARYSTPL 201 T H+ + A L T ++ RTH Y++ +S + P+ S + P S+PL Sbjct: 1052 TTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPSPGTSSSPL 1106
>TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11| Length = 319 Score = 30.8 bits (68), Expect = 0.91 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Frame = +1 Query: 13 YMIHPDSRTRAHTHSLGEAHLQT-----VHTHTARTHL 111 Y++HP + HTH+ H+ +HTHT THL Sbjct: 55 YLLHPHTHVCTHTHTCTHTHIHASTHVCIHTHTF-THL 91
>QUEF_AQUAE (O67073) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-)| Length = 129 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 84 YRLEMRFPERVCVCPCSG 31 Y +E+ FPE C+CP SG Sbjct: 30 YMIEITFPEFTCLCPRSG 47
>VG_DROME (Q26366) Protein vestigial| Length = 453 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 31 SRTRAHTHSLGEAHLQT---VHTHTARTHLYRLVVHKASS 141 S R H HSL AH HTHT +T L+V ++ + Sbjct: 152 SSHRTHAHSLAHAHTHPHSHTHTHTHQTKEEDLIVPRSEA 191
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 121 PNDRDVCVLCVCVPSGDALPRESVCVPVFG 32 PN D C C C P G + ++S C PV G Sbjct: 873 PNPADKCKACACNPYG-TVQQQSSCNPVTG 901
>ASPM_HYLLA (P62290) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 68 RISRRYTHTQHAHISIVWSYTKLAALKDRACQALPQYQRG 187 +I + Y H + +SI + KLAA++ +A + Y RG Sbjct: 2639 KIRKHYLHLRATVVSIQRRHRKLAAVRTQAVICIQSYYRG 2678 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,927,708 Number of Sequences: 219361 Number of extensions: 872349 Number of successful extensions: 2345 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2344 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)