Clone Name | rbart60e07 |
---|---|
Clone Library Name | barley_pub |
>DGAT1_MOUSE (Q9Z2A7) Diacylglycerol O-acyltransferase 1 (EC 2.3.1.20)| (Diglyceride acyltransferase) Length = 498 Score = 29.6 bits (65), Expect = 1.9 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -3 Query: 273 PCMYVV--IFFSRSFQI*FHHAIGRLLSSFSFVRACVHLYALVNLVTLICLSLAV-YYVQ 103 PC+ + IF +FQI A+G L L +VNL T+IC AV V+ Sbjct: 143 PCVIIASNIFVVAAFQIEKRLAVGALTEQMGL------LLHVVNLATIICFPAAVALLVE 196 Query: 102 EIHTIGCVCVL 70 I +G V L Sbjct: 197 SITPVGSVFAL 207
>XRN1_YEAST (P22147) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Strand exchange| protein 1) (KAR(-)-enhancing mutation protein) (5'-3' exoribonuclease) (DNA strand transfer protein beta) (STP-beta) (p175) Length = 1528 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +3 Query: 51 LNQITVEAHTRTQSYVSLVRSTQPN*DKLM-SPN*PVHIN-EHTHARTKNYLTTDRLHDE 224 L +++ E TR Q L+ S P D L SP + + EH H K Y+T E Sbjct: 660 LRKLSPEEKTRNQFGKDLIYSFNPQVDNLYKSPLGGIFSDIEHNHCVEKEYITIPLDSSE 719 Query: 225 IKFGM 239 I++G+ Sbjct: 720 IRYGL 724
>PALI_EMENI (O93956) pH-response regulator protein palI/RIM9| Length = 549 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 75 HTRTQSYVSLVRSTQPN*DKLMSPN*PVHINEHTHARTKN 194 ++RTQSYV R+ P + PN P N+ HAR+++ Sbjct: 474 YSRTQSYVPPRRNWGPQAYQSSEPNLPYQPNQPRHARSQS 513
>VP91_NPVEP (Q91GH8) Capsid-associated protein Vp91 precursor| Length = 826 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 156 VHINEHTHARTKNYLT-TDRLHDEIKFGMN 242 VH N H H + Y+ D L+D+++F N Sbjct: 783 VHYNRHVHVKDGRYMACPDHLYDDVEFRCN 812
>DISI5_CERCE (P83041) Disintegrin CC5 [Contains: Disintegrin CC5B]| Length = 65 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 332 NPPAAQPKQGMHACIAGACVHACMLLS 252 +P +PK+G H CI+G C C LS Sbjct: 9 DPVTCKPKRGEH-CISGPCCRNCKFLS 34
>DIS8A_CERCE (P83043) Disintegrin CC8A| Length = 65 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 332 NPPAAQPKQGMHACIAGACVHACMLLS 252 +P +PK+G H CI+G C C LS Sbjct: 9 DPVTCKPKRGEH-CISGPCCRNCKFLS 34
>DGAT1_RAT (Q9ERM3) Diacylglycerol O-acyltransferase 1 (EC 2.3.1.20)| (Diglyceride acyltransferase) Length = 498 Score = 28.1 bits (61), Expect = 5.5 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -3 Query: 273 PCMYVV--IFFSRSFQI*FHHAIGRLLSSFSFVRACVHLYALVNLVTLICLSLAV-YYVQ 103 PC+ + IF +FQI ++G L L +VNL T+IC AV V+ Sbjct: 143 PCLIIASNIFIVATFQIEKRLSVGALTEQMGL------LLHVVNLATIICFPAAVALLVE 196 Query: 102 EIHTIGCVCVL 70 I +G + L Sbjct: 197 SITPVGSLFAL 207
>DISS_ECHCA (P83658) Disintegrin schistatin| Length = 64 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 332 NPPAAQPKQGMHACIAGACVHACMLLSS 249 +P +P++G H CI+G C C L+S Sbjct: 8 DPVICEPREGEH-CISGPCCENCYFLNS 34
>NSP2_MEDTR (Q5NE24) Nodulation signaling pathway 2 protein| Length = 508 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 159 HINEHTHARTKNYLTTDRLHD 221 H N H H K+YLTT+ HD Sbjct: 180 HNNHHHHNNNKHYLTTNGPHD 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,313,791 Number of Sequences: 219361 Number of extensions: 1037729 Number of successful extensions: 2244 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2240 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)