Clone Name | rbart60d04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZSWM4_MOUSE (Q8C7B8) Zinc finger SWIM domain-containing protein 4 | 29 | 3.2 | 2 | CDAS_BACSH (Q08341) Cyclomaltodextrinase (EC 3.2.1.54) (CDase) (... | 28 | 7.1 | 3 | YPHH_ECOLI (P76586) Hypothetical protein yphH | 27 | 9.2 |
---|
>ZSWM4_MOUSE (Q8C7B8) Zinc finger SWIM domain-containing protein 4| Length = 1101 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -2 Query: 316 KKKRLFSSNTAGQTITNVLTISPADQIWCYGQCLPHACRLQQ 191 +KK L G T T P D I C + L ACRL++ Sbjct: 503 QKKELLQKGATGVTSTEGWVGHPLDPIGCLCRALLEACRLEE 544
>CDAS_BACSH (Q08341) Cyclomaltodextrinase (EC 3.2.1.54) (CDase)| (Cyclomaltodextrin hydrolase, decycling) Length = 591 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 175 HFFPIFAASDRHAEDTGHNTKFDPRAK*SGRLLWFVLRCLKR 300 +F P+FAA+ H DT K DP+ + +L V C R Sbjct: 192 YFNPLFAATTNHKYDTADYMKIDPQFGTNEKLKELVDACHAR 233
>YPHH_ECOLI (P76586) Hypothetical protein yphH| Length = 397 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 298 SSNTAGQTITNVLTISPADQIWCYGQCLPHACRLQQIW 185 S+N G ++ N L I +QIW YG+ +C + W Sbjct: 312 SANAIGLSLYNFLNILNINQIWLYGR----SCAFGENW 345 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,230,573 Number of Sequences: 219361 Number of extensions: 869292 Number of successful extensions: 1893 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1893 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)