Clone Name | rbart60d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CLIC6_RABIT (Q9N2G5) Chloride intracellular channel 6 (Parchorin) | 31 | 0.62 | 2 | MY18B_HUMAN (Q8IUG5) Myosin-18B (Myosin XVIIIb) | 31 | 0.81 | 3 | CADH1_CHICK (P08641) Epithelial-cadherin precursor (E-cadherin) ... | 27 | 9.0 |
---|
>CLIC6_RABIT (Q9N2G5) Chloride intracellular channel 6 (Parchorin)| Length = 637 Score = 31.2 bits (69), Expect = 0.62 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 398 EAQGPGDGVRAGAAEYIRDGEEPPGERDAAGATTK*RRPRQ 276 E PG+ V AAE EP G DAAG RP++ Sbjct: 281 EGHSPGESVEDAAAEEAAGTREPEGSEDAAGEDGDQGRPQE 321
>MY18B_HUMAN (Q8IUG5) Myosin-18B (Myosin XVIIIb)| Length = 2567 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 398 EAQGPGDGVRAGAAEYIRDGEEP 330 +AQGPG+GVR G AE ++G EP Sbjct: 269 QAQGPGEGVRPGKAE--KEGAEP 289
>CADH1_CHICK (P08641) Epithelial-cadherin precursor (E-cadherin) (Cadherin-1)| (Liver cell adhesion molecule) (L-CAM) Length = 887 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 Query: 310 PVLPPSDDVRDNMH 269 P+LPP DD+RDN++ Sbjct: 744 PLLPPEDDMRDNVY 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,258,737 Number of Sequences: 219361 Number of extensions: 1102554 Number of successful extensions: 2743 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2743 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)