ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart60c10 |
|---|---|
| Clone Library Name | barley_pub |
>HME1_HUMAN (Q05925) Homeobox protein engrailed-1 (Hu-En-1)| Length = 392 Score = 35.8 bits (81), Expect = 0.026 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 192 PRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRP 317 P PS P L PPL HP L H P PP L P H+P Sbjct: 54 PAPPSPPAAPCL--PPLAHHPHLPPHPPPPPPQHLAAPAHQP 93
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 31.2 bits (69), Expect = 0.64 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 87 WQPF*NNSLVFLETQNGVGTRGWDRHDTYRSDETTPRCPSVPGHLVLR 230 WQ + N +VFL + GV + + + T+P CPS+P HL R Sbjct: 14 WQSWLPNHVVFLRLREGVRNQSPAEAEKPAAS-TSPSCPSLPPHLPTR 60
>VHS2_YEAST (P40463) Protein VHS2 (Viable in a HAL3 SIT4 background protein 2)| Length = 436 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 7/36 (19%) Frame = +3 Query: 225 LRAPPLQGHPQLGE-------HRPCPPASSLIQPEH 311 LR PP+QGH H P PP++S P+H Sbjct: 228 LRRPPMQGHYSFSSSLLNSPSHLPSPPSASASPPQH 263
>HME1_MOUSE (P09065) Homeobox protein engrailed-1 (Mo-En-1)| Length = 401 Score = 30.4 bits (67), Expect = 1.1 Identities = 21/57 (36%), Positives = 24/57 (42%) Frame = +3 Query: 141 GTRGWDRHDTYRSDETTPRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEH 311 G+ G D S + P PS P L PPL HP L H P PP P+H Sbjct: 37 GSSGSDGDSVPVSPQPAP--PSPPAAPCL--PPLAHHPHLPPHPPPPPPPPPPPPQH 89
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 87 WQPF*NNSLVFLETQNGVGTRGWDRHDTYRSDETTPRCPSVPGHLVLR 230 WQ + N +VFL + G+ + D + T+P CP +P HL R Sbjct: 14 WQSWLPNHVVFLRLREGLKNQSPAEADK-PATSTSPSCPPLPPHLPTR 60
>CD2_MACFA (Q6SZ61) T-cell surface antigen CD2 precursor| Length = 351 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 186 TTPRCPSVPGHLVLRAPPLQGH-PQLGEHRPCPPASSL-IQPEHRPLA 323 +TP+ P+ H PP GH Q HRP PP + QP+ RP A Sbjct: 271 STPQNPAASQH----PPPPPGHRSQAPSHRPLPPGHRVQHQPQKRPPA 314
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = +3 Query: 192 PRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPAS------SLIQPEHRP 317 P P P H+ + P HP+ +PCPP S +++P H P Sbjct: 66 PTTPKHPPHV--KPPSTPKHPKHPPQKPCPPPSHHGPKPPIVKPPHVP 111
>RNPS1_XENLA (Q5XG24) RNA-binding protein with serine-rich domain 1| Length = 283 Score = 28.9 bits (63), Expect = 3.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 226 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPARRRHR 274
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 201 PSVPGHLV-LRAPPLQGH-PQLGEHRPCPPASSLIQPEHRP 317 P P H+ +PP +GH PQ HR PP P H+P Sbjct: 206 PPPPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQP 246
>GLGB_BORPE (Q7VYK0) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 731 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 213 GHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRPLA 323 GH VL+A PL + PPA++ I P+ RP A Sbjct: 203 GHTVLKADPLARQAE------APPATASIVPDERPFA 233
>GLGB_BORPA (Q7W6L4) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 731 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 213 GHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRPLA 323 GH VL+A PL + PPA++ I P+ RP A Sbjct: 203 GHTVLKADPLARQAE------APPATASIVPDERPFA 233
>GLGB_BORBR (Q7WII7) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 731 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 213 GHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRPLA 323 GH VL+A PL + PPA++ I P+ RP A Sbjct: 203 GHTVLKADPLARQAE------APPATASIVPDERPFA 233
>RNPS1_RAT (Q6AYK1) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 248 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPGRRRHR 296
>RNPS1_PONPY (Q5NVM8) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 248 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPGRRRHR 296
>RNPS1_MOUSE (Q99M28) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 248 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPGRRRHR 296
>RNPS1_MACFA (Q4R5N1) RNA-binding protein with serine-rich domain 1| Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 248 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPGRRRHR 296
>RNPS1_HUMAN (Q15287) RNA-binding protein with serine-rich domain 1 (SR-related| protein LDC2) Length = 305 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -2 Query: 359 RRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHR 204 RR S P R+L PM R + R RR P+ R P++RRS RHR Sbjct: 248 RRFSPPRRMLP--PPPMWRRSPPRMRRRSRS-PRRRSPVRRRSRSPGRRRHR 296
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.5 bits (62), Expect = 4.2 Identities = 30/77 (38%), Positives = 33/77 (42%) Frame = -2 Query: 371 PRGSRRSSTPWRLLTRRQRPMLRLNQARCRRTGAMLPQLRMPLQRRSPQHQMPRHRWTSR 192 PRG RR S P TRR+R R RRT P+ R P SP PR R S Sbjct: 542 PRGRRRRS-PSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTP----SPP---PRRRSPSP 593 Query: 191 RRLV*SIRVMSVPPPCP 141 RR I+ P P P Sbjct: 594 RRYSPPIQRRYSPSPPP 610
>MTSS1_HUMAN (O43312) Metastasis suppressor protein 1 (Missing in metastasis| protein) (Metastasis suppressor YGL-1) Length = 755 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 189 TPRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPA 287 TP P +PG VL APP G + GEH P P+ Sbjct: 620 TPTVPDLPG--VLPAPP-DGPEERGEHSPESPS 649
>SYNPO_MOUSE (Q8CC35) Synaptopodin| Length = 929 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 210 PGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRP 317 PG + P+ G Q GE PPASS+ +P Sbjct: 480 PGTSQIEQSPMMGRRQFGEKAWAPPASSMADRSPQP 515
>POL_HTLV2 (P03363) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 982 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 180 LIDTCHVCPTPLSQHH 133 L+ TCH C T SQHH Sbjct: 716 LVQTCHTCQTINSQHH 731
>SRPK1_HUMAN (Q96SB4) Serine/threonine-protein kinase SRPK1 (EC 2.7.11.1)| (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) (SFRS protein kinase 1) Length = 826 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 201 PSVPGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRP 317 P P PLQG P LG R PPA L +PE P Sbjct: 75 PLFPARPARALGPLQG-PALGGRRRPPPARPLTRPETPP 112
>BPAEB_HUMAN (Q8WXK8) Bullous pemphigoid antigen 1, isoform 7 (Bullous pemphigoid| antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) (Fragment) Length = 3060 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 207 VPGHLVLRAPPLQGHPQLG 263 VP H+++ APP++ H QLG Sbjct: 2666 VPSHVLITAPPMKEHLQLG 2684
>YTDC1_RAT (Q9QY02) YTH domain-containing protein 1 (Putative splicing factor| YT521) (RA301-binding protein) Length = 738 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 153 WDRHDTYRSDETTPRCPSVPGHLVLRAPPLQGHPQLGEHRPCP 281 W Y E P P H APP Q HP H P P Sbjct: 616 WQGMPPYPGIEQPPHHPYYQHH----APPPQAHPPYSGHHPVP 654
>YTDC1_HUMAN (Q96MU7) YTH domain-containing protein 1 (Putative splicing factor| YT521) Length = 727 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 153 WDRHDTYRSDETTPRCPSVPGHLVLRAPPLQGHPQLGEHRPCP 281 W Y E P P H APP Q HP H P P Sbjct: 605 WQGMPPYPGMEQPPHHPYYQHH----APPPQAHPPYSGHHPVP 643
>L100_ADEP3 (Q9YTR7) Late 100 kDa protein| Length = 838 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 165 DTYRSDETTPRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHR 314 D + +E PS H APP + HPQ +H+ QP HR Sbjct: 692 DPHTGEELNTAAPSTAHHA---APPEEAHPQQHQHQQ--------QPSHR 730
>NFAC4_HUMAN (Q14934) Nuclear factor of activated T-cells, cytoplasmic 4| (NF-ATc4) (NFATc4) (T cell transcription factor NFAT3) (NF-AT3) Length = 902 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +3 Query: 177 SDETTPRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPASSLIQPEHRP 317 S++ P C L L PP G +G RP PP + P RP Sbjct: 37 SEDAPPCC-----RLALGEPPPYGAAPIGIPRPPPPRPGMHSPPPRP 78
>WWP1_MOUSE (Q8BZZ3) NEDD4-like E3 ubiquitin-protein ligase WWP1 (EC 6.3.2.-)| (WW domain-containing protein 1) Length = 918 Score = 27.7 bits (60), Expect = 7.1 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 186 TTPRCPSVPGHLVLRAPPLQGHPQLGEHRPC-PPASSLIQPEHRPL 320 +T C S + PP+Q P EH C P AS+ + PE R L Sbjct: 268 STSNCTST----TTQEPPVQEPPASSEHSECIPSASAEVGPEARSL 309
>INO80_EMENI (Q5BAZ5) Putative DNA helicase ino80 (EC 3.6.1.-)| Length = 1612 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 225 LRAPPLQGHPQLGEHRPCPPASS 293 L PP HP++G+ P PP S+ Sbjct: 222 LNPPPASFHPKVGDIEPVPPVSA 244
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -2 Query: 362 SRRSSTPWRLLTRRQRPMLRLNQARCRRTGAML---PQLRMPLQRRSPQH 222 SRR +TP+ + + + ++ +QA CR L P +P+ + PQH Sbjct: 114 SRRPNTPYFICSIQDFKLVHNSQACCRSPAPALCDPPACSLPVASQPPQH 163
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 186 TTPRCP-SVPGHLVLRAPPLQGHPQLG 263 TTP SVPGH+ L P L G P +G Sbjct: 3350 TTPTSSASVPGHVTLTNPRLLGTPDIG 3376
>CARP8_CANAL (O42778) Candidapepsin-8 precursor (EC 3.4.23.24) (Aspartate| protease 8) (ACP 8) (Secreted aspartic protease 8) Length = 405 Score = 27.3 bits (59), Expect = 9.3 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 1 HHMIDKNQAGQTQAPQSCRGTEAKSTHNDG--NLSKTTV*SFWKLRMVLGQGGGTDMTRI 174 HH + Q Q Q P RGT S N+G + TV S + + V+ G +D+ + Sbjct: 57 HHQSQQQQQQQQQQPAQKRGTVQTSLINEGPSYAATITVGSNKQQQTVIVDTGSSDLWVV 116 Query: 175 D 177 D Sbjct: 117 D 117
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +3 Query: 123 ETQNGVGTRGWD-RHDTYRSDETTPRCPSVPGHL 221 +T+ G G+R +D + + YR + +P ++PGH+ Sbjct: 2077 QTETGEGSRKYDGQPNRYRQQQESPPQQTIPGHV 2110
>MTSS1_MOUSE (Q8R1S4) Metastasis suppressor protein 1 (Missing in metastasis| protein) Length = 759 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 189 TPRCPSVPGHLVLRAPPLQGHPQLGEHRPCPPAS 290 TP P +PG VL +PP G + GEH P P++ Sbjct: 624 TPTVPDLPG--VLPSPP-DGPEERGEHSPESPSA 654 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,628,285 Number of Sequences: 219361 Number of extensions: 1022116 Number of successful extensions: 2908 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 2798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2905 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
