| Clone Name | rbart60c07 |
|---|---|
| Clone Library Name | barley_pub |
>MAST1_HUMAN (Q9Y2H9) Microtubule-associated serine/threonine-protein kinase 1 (EC| 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) Length = 1570 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 139 TPPPNPNSTLYADHSHARSPKKLHQSDPVV 228 +PPP P T+ + H+ P KLH S PVV Sbjct: 1217 SPPPLPGHTVGSSHTTQSFPAKLHSSPPVV 1246
>MAST1_RAT (Q810W7) Microtubule-associated serine/threonine-protein kinase 1 (EC| 2.7.11.1) (Syntrophin-associated serine/threonine-protein kinase) Length = 1570 Score = 32.3 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 139 TPPPNPNSTLYADHSHARSPKKLHQSDPVV 228 +PPP P T+ + H+ P KLH S P+V Sbjct: 1219 SPPPLPGHTVGSSHTTQSFPAKLHSSPPIV 1248
>PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associated protein| (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) Length = 788 Score = 31.2 bits (69), Expect = 0.63 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +1 Query: 118 MNYKQSHTPPPNPNSTLYADHSHARSPKKLHQSDPVVD*APTIQQALPGWLI 273 M++ Q H PPP P A + ++ P + Q+ P+V A QALPG ++ Sbjct: 293 MHHTQHHQPPPQPQQPPVAQNQPSQLPPQ-SQTQPLVSQA----QALPGQML 339
>LGE1_YEAST (Q02796) Transcriptional regulatory protein LGE1 (Large cells| protein 1) Length = 332 Score = 31.2 bits (69), Expect = 0.63 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 82 SSTRGFFTSYT*MNYKQSHTPPPNPNSTLYADHSHARSPKKLHQSD 219 SS + +S+T NY TPPP P++ YA P+ SD Sbjct: 188 SSAYPYSSSHTYNNYHHRETPPPPPSNGYYAKGYPVHVPENRSNSD 233
>JPH1_HUMAN (Q9HDC5) Junctophilin-1 (Junctophilin type 1) (JP-1)| Length = 661 Score = 30.8 bits (68), Expect = 0.82 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 124 YKQSHTPPPNPNSTLYADHSHARSPKKLHQSDP 222 Y++ TPP +P ++ HS A SPK L + +P Sbjct: 456 YRKGTTPPRSPEASPKHSHSPASSPKPLKKQNP 488
>GBF1_HUMAN (Q92538) Golgi-specific brefeldin A-resistance guanine nucleotide| exchange factor 1 (BFA-resistant GEF 1) Length = 1859 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 361 LVSCPRKEP-SHRGADKTSPALRCA*MCSRISASPEGPVELLEP 233 L +C ++P S R A +SP A SR+S +P+GP L +P Sbjct: 1763 LGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGPPPLAQP 1806
>TTP_BOVIN (P53781) Tristetraproline (TTP) (Zinc finger protein 36 homolog)| (Zfp-36) (TIS11A protein) (TIS11) Length = 324 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 121 NYKQSHTPPPNPNSTLYADHSHARSPKKLHQSDPVVD*APTIQQALP 261 ++ S +PPP P L + + + +P L + DP P+ ++A P Sbjct: 210 SFSPSSSPPPPPGDLLLSPSAFSAAPGHLCRRDPTPACCPSCRRATP 256
>GBF1_CRIGR (Q9R1D7) Golgi-specific brefeldin A-resistance guanine nucleotide| exchange factor 1 (BFA-resistant GEF 1) Length = 1856 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 355 SCPRKEPSH-RGADKTSPALRCA*MCSRISASPEGPVELLEP 233 +C ++P R +SP A SR+S SPEGP L +P Sbjct: 1762 ACDSEKPEGTRATSSSSPGSPVASSPSRLSPSPEGPPPLAQP 1803
>KTHY_METMA (Q8PXV5) Probable thymidylate kinase (EC 2.7.4.9) (dTMP kinase)| Length = 206 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 46 PSITCFQSVFTRSSTRGFFTSYT*MNYKQSHTPPPNPNSTLYADHS 183 P I F VFTR TRG T N QS T ADH+ Sbjct: 27 PEIQVFDPVFTREPTRGTLTGTAVENAIQSETDQLAELFLFTADHA 72
>YL18_CAEEL (Q11103) Hypothetical protein C02F12.8| Length = 687 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = +2 Query: 50 PSPVFSQYSPVPVQGAFSPLIHE*ITNNHTRHHPIQTLLCMLIILMHGPQKNCINQTLSS 229 PSP +SQYS P F +I++ NN + + + ++ + C +Q+ SS Sbjct: 230 PSPSYSQYSGPPANEGFPDIIYD---NNGVAYCRVVSAPVCVVSMSQSGSSVCSSQSFSS 286
>VG02_VARV (P32992) Isatin-beta-thiosemicarbazone-dependent protein (Protein| G2) Length = 220 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +3 Query: 75 HPFQYKGLFHLLYMNELQTITHATTQSKLYFVC*SFSCTVPKKTASIRPCRRLGSN 242 H + YK H+ EL H TT L ++ + K + IRPC +LG N Sbjct: 50 HKYIYKVFEHVDLSEELSMEFHDTTLRDLVYL------KLYKYSKCIRPCYKLGDN 99
>APEX2_BOVIN (Q5E9N9) DNA-(apurinic or apyrimidinic site) lyase 2 (EC 4.2.99.18)| (Apurinic-apyrimidinic endonuclease 2) (AP endonuclease 2) Length = 514 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 297 DAHRCAAGYQPARKGLLNCWSLV 229 D++RC +QP +KG CWS V Sbjct: 245 DSYRC---FQPKQKGAFTCWSTV 264
>PABP1_RAT (Q9EPH8) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 38 VRFHPSPVFSQYSPVPVQGAFSPLIHE*ITNNHTRHHP 151 VR P+PV + Y P P G F I + T N ++P Sbjct: 389 VRAVPNPVINPYQPAPPSGYFMAAIPQ--TQNRAAYYP 424
>PABP1_MOUSE (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 38 VRFHPSPVFSQYSPVPVQGAFSPLIHE*ITNNHTRHHP 151 VR P+PV + Y P P G F I + T N ++P Sbjct: 389 VRAVPNPVINPYQPAPPSGYFMAAIPQ--TQNRAAYYP 424
>PABP1_HUMAN (P11940) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 38 VRFHPSPVFSQYSPVPVQGAFSPLIHE*ITNNHTRHHP 151 VR P+PV + Y P P G F I + T N ++P Sbjct: 389 VRAVPNPVINPYQPAPPSGYFMAAIPQ--TQNRAAYYP 424
>PABP1_BOVIN (P61286) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 38 VRFHPSPVFSQYSPVPVQGAFSPLIHE*ITNNHTRHHP 151 VR P+PV + Y P P G F I + T N ++P Sbjct: 389 VRAVPNPVINPYQPAPPSGYFMAAIPQ--TQNRAAYYP 424
>PRIM_TREPA (O83505) DNA primase (EC 2.7.7.-)| Length = 605 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 364 HLVSCPRKEPSHRGADKTSPAL 299 +L+ C R E SH GAD TS A+ Sbjct: 366 YLIRCARHEHSHLGADDTSRAV 387
>INTL_ECOLI (Q47036) Probable site-specific recombinase in afa region| Length = 246 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 42 DSIHHLFSVSIHPFQYKGLFHLLYMNELQTITHA 143 D +H SV+ H F++ + H+LY + + + A Sbjct: 166 DGVHFSISVTPHTFRHSYIMHMLYHRQPRKVIQA 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,453,172 Number of Sequences: 219361 Number of extensions: 1344729 Number of successful extensions: 3147 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 3052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3144 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)