Clone Name | rbart60c03 |
---|---|
Clone Library Name | barley_pub |
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 249 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 133 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>NUP1_YEAST (P20676) Nucleoporin NUP1 (Nuclear pore protein NUP1)| Length = 1076 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 2 EECTSSCLITMANKLTHQHNHNYTGFNHHKKKQESPT 112 E S+ AN + ++T FNH+K+K SPT Sbjct: 733 ESMKSTASTAAANTEKLSNGFSFTKFNHNKEKSNSPT 769
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 194 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCF 310 +IC A++++ R TC +C ++ T + ++++ L+CF Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECF 213
>MYF5_XENLA (P24700) Myogenic factor 5 (Myf-5)| Length = 255 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 14 SSCLITMANKLTHQHNHNYTGFNHHKKKQESPT*NVHIR*GDPI-HRKNNKCSMRVRTFA 190 SSC+ + T + H + + HKK E + H+R PI H + C M +A Sbjct: 18 SSCIPSPEEGYTEDYEHGMSIYGAHKKDLEESDEDEHVR--APIGHHQAGNCLM----WA 71 Query: 191 CVIC 202 C C Sbjct: 72 CKAC 75
>SNF1_CANAL (P52497) Carbon catabolite derepressing protein kinase (EC| 2.7.11.1) Length = 620 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 35 ANKLTHQHNHNYTGFNHHKKKQES 106 A++ HQHNH++ +HH + +S Sbjct: 11 ADQQQHQHNHHHHHHHHHHNENQS 34
>CLK1_HUMAN (P49759) Dual specificity protein kinase CLK1 (EC 2.7.12.1)| (CDC-like kinase 1) Length = 484 Score = 27.3 bits (59), Expect = 9.0 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = -1 Query: 311 ENILSYCEFVVALPCQGSCTKVSTYVRTYDDALHLPCISRMQTYVHAWNICYSFDGSGLL 132 +N+ YCE S +V ++ T D C+ ++ + H +IC F+ GL Sbjct: 194 KNVDRYCE------AARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLS 247 Query: 131 TVCVHFTWGFLAF 93 T GFL F Sbjct: 248 TYDFIKENGFLPF 260
>BEX3_RAT (Q6PDU5) Protein BEX3 (Brain-expressed X-linked protein 3 homolog)| (rBex3) (p75NTR-associated cell death executor) (Nerve growth factor receptor-associated protein 1) Length = 130 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +2 Query: 35 ANKLTHQHNHNYT---GFNHHKKKQ 100 AN H HNHN+ NHH++ Q Sbjct: 34 ANNNNHNHNHNHNHNHNHNHHRRGQ 58
>S28A1_RAT (Q62674) Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside| cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Concentrative nucleoside transporter 1) (CNT 1) Length = 648 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 213 ALAMHITHANVRTRMEHLLFFRWIGSPHRMCTFYVGLSCFFLW 85 ALA+ I V + + L R +GS R C + G SC LW Sbjct: 109 ALALLIITCVVLVFLAYDLLKRLLGSKLRRCVKFQGHSCLSLW 151
>MATK_PSEMZ (Q9MV48) Maturase K (Intron maturase)| Length = 515 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Frame = -3 Query: 231 YVR--RRTALAMHITHANVRTRMEHLLFFR------WIGSPHRMCTFYVGLSC 97 YVR R+ +A+ TH V+ HLL FR W P+R+C+ + +C Sbjct: 274 YVRYGERSIIAIKGTHLLVKKCRYHLLIFRQCYFHLWF-EPYRVCSHQLSKNC 325
>RNAS1_MICNV (Q9WUV3) Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1)| (RNase A) Length = 148 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -1 Query: 266 QGSCTKVSTYVRTYDDALHLPCISRMQTYVHAWNICYSFDGSGLLTVC 123 QG C V+T+V A+H C + T + + CY + +T C Sbjct: 61 QGYCKPVNTFVHEPQTAVHAVCSQKNVTCKNGNSNCYKSHSALHITDC 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,464,736 Number of Sequences: 219361 Number of extensions: 1190310 Number of successful extensions: 2953 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2939 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)