| Clone Name | rbart60b07 |
|---|---|
| Clone Library Name | barley_pub |
>IPYR_MAIZE (O48556) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 214 Score = 32.0 bits (71), Expect = 0.40 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 313 EAIQHSMDLYATYICEGLRR 254 EAIQ+SMDLYA YI + LR+ Sbjct: 195 EAIQYSMDLYAQYILQSLRQ 214
>IPYR_HORVD (O23979) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 215 Score = 32.0 bits (71), Expect = 0.40 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 313 EAIQHSMDLYATYICEGLRR 254 EAIQ+SMDLYA YI + LR+ Sbjct: 196 EAIQYSMDLYAQYILQSLRQ 215
>IPYR_SOLTU (Q43187) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 211 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 310 AIQHSMDLYATYICEGLRR 254 AIQ+SMDLYA YI LR+ Sbjct: 193 AIQYSMDLYAEYILHSLRK 211
>IPYR_ARATH (P21216) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 218 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 313 EAIQHSMDLYATYICEGLRR 254 +AI+ SMDLYA YI GL+R Sbjct: 199 DAIKDSMDLYAAYIKAGLQR 218
>EX5B_BUCAI (P57529) Exodeoxyribonuclease V beta chain (EC 3.1.11.5)| Length = 1174 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/41 (26%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = -2 Query: 220 LDDVDEKLFVSRA----LSTSSVISIHTFLFYVTYLHTYTY 110 + D+ E ++V + +++SS+ +IH+F ++ LHT+ + Sbjct: 106 IHDIKEAIYVLKRAQNDMNSSSIYTIHSFCQHILQLHTFHF 146
>CARA_DEIRA (Q9RWI4) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 394 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -2 Query: 136 VTYLHTYTYILLVYDIDPPKPCIKAVVAAR*TGHSFPNY 20 +TY H Y + +YD++ KP ++ ++ +G + NY Sbjct: 57 ITYPHVGNYGVAIYDMESNKPYVRGFISREFSG-EYSNY 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,780,541 Number of Sequences: 219361 Number of extensions: 785130 Number of successful extensions: 1677 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1677 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)