Clone Name | rbart60b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ASO_CUCPM (P37064) L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase)... | 35 | 0.043 | 2 | ASO_CUCMA (P24792) L-ascorbate oxidase precursor (EC 1.10.3.3) (... | 35 | 0.043 | 3 | ASO_TOBAC (Q40588) L-ascorbate oxidase precursor (EC 1.10.3.3) (... | 32 | 0.47 | 4 | ASO_CUCSA (P14133) L-ascorbate oxidase precursor (EC 1.10.3.3) (... | 31 | 0.62 | 5 | Y1282_METJA (Q58678) Hypothetical UPF0252 protein MJ1282 | 28 | 4.0 | 6 | CYB_MYOYA (Q7Y8K8) Cytochrome b | 28 | 6.8 |
---|
>ASO_CUCPM (P37064) L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase) (ASO)| Length = 552 Score = 35.0 bits (79), Expect = 0.043 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -2 Query: 402 MGMGVAFEEGIERVGKLPEEITRC 331 MGMGV F EG+E+VG++P + C Sbjct: 515 MGMGVVFAEGVEKVGRIPTKALAC 538
>ASO_CUCMA (P24792) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 579 Score = 35.0 bits (79), Expect = 0.043 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -2 Query: 402 MGMGVAFEEGIERVGKLPEEITRC 331 MGMGV F EG+E+VG++P + C Sbjct: 545 MGMGVVFAEGVEKVGRIPTKALAC 568
>ASO_TOBAC (Q40588) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 578 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 402 MGMGVAFEEGIERVGKLPEEITRC 331 MGMGV F EG+ V K+P+E C Sbjct: 542 MGMGVIFAEGVHLVKKIPKEALAC 565
>ASO_CUCSA (P14133) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 587 Score = 31.2 bits (69), Expect = 0.62 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 402 MGMGVAFEEGIERVGKLPEEITRCVS 325 MGMGV F EG+ VG +P + C S Sbjct: 551 MGMGVVFAEGVHMVGMIPPKALACGS 576
>Y1282_METJA (Q58678) Hypothetical UPF0252 protein MJ1282| Length = 352 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 135 LRHMLISFSLSLILQHIFQ*ANCWTINHVC 46 +R +++ F + LILQ+I+ + +NHVC Sbjct: 1 MRKIILIFFIFLILQNIYAYEKIYDVNHVC 30
>CYB_MYOYA (Q7Y8K8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 6.8 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = -3 Query: 227 FFTFNYLFSQTFTVEILSSNSLYFSFGSNRA*GICS----YPFHYL*YYNTFSSEQIVGL 60 FFTF++LF ++ GSN GI S PFH YY + + ++GL Sbjct: 178 FFTFHFLFPFIVAAMVMVHLLFLHETGSNNPTGIPSNTDMIPFHP--YY---TIKDVLGL 232 Query: 59 LIMYVQII 36 L+M ++ Sbjct: 233 LLMITALL 240 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,497,541 Number of Sequences: 219361 Number of extensions: 748261 Number of successful extensions: 1860 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1860 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)