Clone Name | rbart59h06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | 5E5_RAT (Q63003) 5E5 antigen | 30 | 1.5 | 2 | UPPS_XANOR (Q5H1E5) Undecaprenyl pyrophosphate synthetase (EC 2.... | 29 | 3.3 | 3 | ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 29 | 3.3 | 4 | VIT6_CAEEL (P18948) Vitellogenin 6 precursor | 28 | 7.3 | 5 | LCR11_ARATH (P82726) Putative low-molecular-weight cysteine-rich... | 28 | 7.3 | 6 | PG24_MYCTU (Q10637) Hypothetical PE-PGRS family protein PE_PGRS2... | 28 | 7.3 |
---|
>5E5_RAT (Q63003) 5E5 antigen| Length = 825 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 339 SAGEQGCRCARGRAPGAGELVGAEAQVHGQGGR-WAMDA 226 S GE G RGR GAGE + G+GGR W +A Sbjct: 292 SPGEWGADVPRGRGEGAGEWGSDVPKDRGEGGREWGPEA 330
>UPPS_XANOR (Q5H1E5) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 258 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 299 HPVPASWWVPKHKFMVKGGDGRW 231 HPVP VP+H ++ G+GRW Sbjct: 7 HPVPPVADVPRHIAIIMDGNGRW 29
>ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) Length = 920 Score = 28.9 bits (63), Expect = 3.3 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 118 PRSWQRAQRRESHQRPLSS**MADASNLT*MCLKSWSVHRPSPP 249 P + R +R+ES +RP S M A N CL S RP PP Sbjct: 821 PEAGARIERKESARRPPPSRPMPPAPN----CLLSQDFSRPRPP 860
>VIT6_CAEEL (P18948) Vitellogenin 6 precursor| Length = 1650 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 67 NGKYTRNGRQTVSRYLEP--RSWQRAQRRESHQRPLS 171 NGK + +Q S Y P SW R Q RE + PL+ Sbjct: 1580 NGKSQESKKQKTSVYCLPSSNSWARRQMREIRREPLA 1616
>LCR11_ARATH (P82726) Putative low-molecular-weight cysteine-rich protein LCR11| precursor Length = 102 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -2 Query: 257 MVKGGDGRWTLQDFKHI*VKLLASAIH*EESGR*CDSRRCARCQDRGSK*RLTVCRP 87 MVKG G+ + + +K+L +A H + CDS+ C ++ S ++ C+P Sbjct: 23 MVKGTVGK------QRLCIKVLTNASHVSKGASTCDSKLCTSLCEKISPQGVSFCKP 73
>PG24_MYCTU (Q10637) Hypothetical PE-PGRS family protein PE_PGRS24 precursor| Length = 603 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 300 APGAGELVGAEAQVHGQGGRWAMDAPG 220 APG G+ GA ++G GG APG Sbjct: 125 APGTGQAGGAGGLLYGNGGAGGSGAPG 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,375,591 Number of Sequences: 219361 Number of extensions: 978014 Number of successful extensions: 2526 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2525 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)