Clone Name | rbart59h02 |
---|---|
Clone Library Name | barley_pub |
>DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protein dicer-1)| Length = 2249 Score = 30.0 bits (66), Expect = 1.5 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +1 Query: 34 DRNDNRVHRKYTQNPLSI*--PKWSGNSRTVQSGSRTCTKPTTTRRSSKEKRDGTDNQCI 207 DR NR + T P PK S + T Q +R + TRR ++ DG+D C Sbjct: 439 DRQTNRSAARVTPTPTPAHAKPKPSSGANTAQPRTR---RRVYTRRHHRDHNDGSDTLCA 495 Query: 208 IVH 216 +++ Sbjct: 496 LIY 498
>CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1| Length = 411 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 83 LYNQNGAVIHVQYRAEAEHALNQPLPADHQKKNGTGRTTNASSYIKN 223 L N N ++ V A+AE A + L +++KK T T N S + N Sbjct: 325 LTNDNSRLLEVMKNAQAERAADVGLGNNNEKKASTLSTANLLSRVDN 371
>POL4_DROME (P10394) Retrovirus-related Pol polyprotein from transposon 412| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1237 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 20 LLNGWTEMIIEYTENIHKILSLYNQNGAVIHVQYRAEAEHALNQPLPADHQKKN 181 L+ G T + ++ +H I +YN + +YR E +A + L H++KN Sbjct: 1114 LVFGRTSNLPKHFNKLHSIEPIYNIDDYAKESKYRLEVAYARARKLLEAHKEKN 1167
>RPC2B_CHLRE (Q8HUH0) DNA-directed RNA polymerase beta' chain C-terminal subunit| (EC 2.7.7.6) (PEP) (Plastid-encoded RNA polymerase beta' C-terminal section) (RNA polymerase beta' C-terminal section) Length = 489 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +2 Query: 53 YTENIHKILSLYNQNGAVIH------VQYRAEAEHALNQPL 157 Y NIH++L YNQ+ +H +Q E + + QPL Sbjct: 279 YFHNIHEVLKAYNQHLIHLHAVIWVNIQGHLETANNIEQPL 319
>DDEF1_BOVIN (O97902) 130-kDa phosphatidylinositol 4,5-biphosphate-dependent| ARF1 GTPase-activating protein (PIP2-dependent ARF1 GAP) (ADP-ribosylation factor-directed GTPase-activating protein 1) (ARF GTPase-activating protein 1) (Development and differe Length = 1129 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 261 DTKEEKSSSDAREGGHSMH 317 D KE + S +R+GG+SMH Sbjct: 300 DQKESRRDSQSRQGGYSMH 318 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,874,493 Number of Sequences: 219361 Number of extensions: 745191 Number of successful extensions: 1934 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1934 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)