Clone Name | rbart59g06 |
---|---|
Clone Library Name | barley_pub |
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 32.3 bits (72), Expect = 0.30 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 113 CDT*LVLQLSCFV*SALQHGADQNHTCRL--FCLSAGRYHYCTC 238 CD VL +SC +ALQ G H C+ C++AG H+C C Sbjct: 1098 CD---VLNVSCKA-AALQKGVPVEHLCQHSGICINAGNTHHCQC 1137
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 32.3 bits (72), Expect = 0.30 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 113 CDT*LVLQLSCFV*SALQHGADQNHTCRL--FCLSAGRYHYCTC 238 CD VL +SC +ALQ G H C+ C++AG H+C C Sbjct: 1096 CD---VLNVSCKA-AALQKGVPVEHLCQHSGICINAGNTHHCQC 1135
>STCQ_EMENI (Q00713) Putative sterigmatocystin biosynthesis protein stcQ| Length = 274 Score = 29.3 bits (64), Expect = 2.5 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +1 Query: 124 TRPAIELLCLICFATRC*SESYMPFI-LPVSW*VPLLYMHI--DCTHA*LSIRTQSDWSQ 294 T PAI L L+ ++ ++ + PV W + H+ D A +R QSDW Sbjct: 112 TDPAIRLPRLVILSSASLEPTFCNDVPAPVHWVLKTAVSHLYRDLAAAEAYLRAQSDWLS 171 Query: 295 YDIHTGGGLISDAA 336 GGL+ D A Sbjct: 172 ATFVKPGGLVHDQA 185
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 113 CDT*LVLQLSCFV*SALQHGADQNHTCRL--FCLSAGRYHYCTC 238 CD V +SC + +A + G H C+ C++AG HYC C Sbjct: 1098 CD---VPNVSCDI-AASRRGVLVEHLCQHSGVCINAGNTHYCQC 1137
>PUR5_PROMP (Q7UZR7) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 347 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +1 Query: 169 RC*SESYMPFILPVSW*VPLLYMHIDCTHA*LSIRTQSDWSQYDIHTGGGLISD 330 RC S ++P+I SW +P+L+ + I + W+ +++ G LI D Sbjct: 256 RCMSSDFIPYIDKKSWKIPVLFEFLKDVG---QIPEKDFWNTFNLGVGFCLIID 306
>INCE_HUMAN (Q9NQS7) Inner centromere protein| Length = 923 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -3 Query: 218 YQLTGRINGMYDSDQHRVAKQIKQSSSIAGRVMCHMY 108 Y L + + R+AK+ + + +GR++CH Y Sbjct: 322 YSLVAKQESVVRRASRRLAKKTAEEPAASGRIICHSY 358 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,568,248 Number of Sequences: 219361 Number of extensions: 788802 Number of successful extensions: 1379 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)