Clone Name | rbart59f07 |
---|---|
Clone Library Name | barley_pub |
>CT116_MOUSE (Q80WW9) Protein C20orf116 homolog precursor| Length = 315 Score = 60.1 bits (144), Expect = 1e-09 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 410 LSGVMDDRGKFIYISIEEMQAVADYIRKHGRVSISHLANNSNEFI 276 L+GV+DDRGKFIYI+ EE+ AVA++IR+ GRVSI+ LA SN I Sbjct: 259 LTGVIDDRGKFIYITPEELAAVANFIRQRGRVSITELAQASNSLI 303
>YO87_CAEEL (P34623) Hypothetical protein ZK1236.7| Length = 324 Score = 59.7 bits (143), Expect = 2e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -3 Query: 410 LSGVMDDRGKFIYISIEEMQAVADYIRKHGRVSISHLANNSNEFIDLE 267 + GVMDDRGKFIYIS EE AVA +I + GRVSI +A SN I LE Sbjct: 271 VQGVMDDRGKFIYISDEEFAAVAKFINQRGRVSIHEIAEQSNRLIRLE 318
>CT116_HUMAN (Q96HY6) Protein C20orf116 precursor| Length = 314 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 410 LSGVMDDRGKFIYISIEEMQAVADYIRKHGRVSISHLANNSNEFI 276 ++GV+DDRGKFIYI+ EE+ AVA++IR+ GRVSI+ LA SN I Sbjct: 258 ITGVIDDRGKFIYITPEELAAVANFIRQRGRVSIAELAQASNSLI 302
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 32.3 bits (72), Expect = 0.27 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -3 Query: 374 YISIEEMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDE 222 Y S ++ V DY+RK ++ A N I+LE K L EKE ++ E Sbjct: 125 YCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKL--EKESKNEQE 173
>ZN645_HUMAN (Q8N7E2) Zinc finger protein 645| Length = 425 Score = 32.3 bits (72), Expect = 0.27 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -3 Query: 359 EMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDESAPAGIVAE 195 + + V+ + RKHG +++ H+ NNS+ P Y + +S S+P I+ + Sbjct: 224 QWETVSIFTRKHGNLTVDHIQNNSDSGAKKPTPPDYYPECQSQPAVSSPHHIIPQ 278
>ZN645_MACFA (Q4R361) Zinc finger protein 645| Length = 422 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -3 Query: 359 EMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDESAPAGIVAE 195 + + V+ + RKHG + + H+ NNS+ P Y + +S S+P I+ + Sbjct: 221 QWETVSVFTRKHGNLIVDHIQNNSDSGAKKPSPPDYYPEYQSQPVVSSPCHIMPQ 275
>ULK1_MOUSE (O70405) Serine/threonine-protein kinase ULK1 (EC 2.7.11.1)| (Unc-51-like kinase 1) (Serine/threonine-protein kinase Unc51.1) Length = 1051 Score = 28.9 bits (63), Expect = 3.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 158 QGQQARP*ALIRALQLCPLGRFHLDDSPPSHRTGAL 265 Q Q AR A+ R+ PLG SPPSH GA+ Sbjct: 453 QQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAM 488
>HBL1_CAEEL (Q9XYD3) Hunchback-like protein| Length = 982 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = -3 Query: 359 EMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDESAPAGIVA 198 E+ A A IRK SI + ++ F+++EPK + ++ +E APA V+ Sbjct: 249 EVFAEAAKIRKSSSESIGFQRSGTSAFLNIEPKEM-SMSSANNNNEEAPASTVS 301
>CYSP1_LEIPI (P35591) Cysteine proteinase 1 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-1) Length = 354 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 275 DLEPKPLYDEKEESHQDESAPAGIVA 198 D + L D KE+ H D+SAP+G+++ Sbjct: 107 DYYARHLKDHKEDVHVDDSAPSGVMS 132
>GLYA_SILPO (Q5LPA8) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine| methylase) (SHMT) Length = 431 Score = 24.3 bits (51), Expect(2) = 6.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 380 FIYISIEEMQAVADYIRKHGRVSISHLANNSNEFIDLEPK 261 +I I QA++D + K G +++H + +DL PK Sbjct: 293 YIQQVIANAQALSDQLIKGGLDTVTHGTDTHVVLVDLRPK 332 Score = 21.9 bits (45), Expect(2) = 6.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 219 RPSGHSCRALMSAHGRACCPCNKASI 142 RP G A A GRA CNK + Sbjct: 330 RPKGVKGNATEKALGRAHITCNKNGV 355
>SPK1_CAEBR (Q61IS6) Serine/threonine-protein kinase spk-1 (EC 2.7.11.1)| Length = 771 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 251 DEKEESHQDESAPAGIVAEP 192 D++EE H D P+G++ EP Sbjct: 738 DDEEEFHMDRPGPSGVINEP 757
>TT1_ARATH (Q8VWG3) TRANSPARENT TESTA 1 protein (Zinc finger protein TT1)| (TTL1) Length = 303 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 293 NSNEFIDLEPKPLYDEKEESHQDE 222 N N +DL P PLY E+ E ++E Sbjct: 52 NLNSNLDLNPNPLYAEEGEQEEEE 75
>P80C_HUMAN (P38432) Coilin (p80)| Length = 576 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -3 Query: 362 EEMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDE--KEESHQDESAPAGIVAE 195 EE + Y +KH + ++ NN+ + +DLEPK + D+ +++ + A G V + Sbjct: 120 EETEPDCKYSKKHWKSRENN--NNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGD 175
>DAM1_CANGA (Q6FLB2) DASH complex subunit DAM1 (Outer kinetochore protein DAM1)| Length = 307 Score = 27.3 bits (59), Expect = 8.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 269 EPKPLYDEKEESHQDESAPAGIVAEP 192 E P+YD+K E+ +D ++ A V+ P Sbjct: 186 ENPPVYDDKREADEDTNSEASFVSNP 211
>ACON_GRAVE (P49609) Aconitate hydratase, mitochondrial precursor (EC 4.2.1.3)| (Citrate hydro-lyase) (Aconitase) Length = 779 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 347 VADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDESAP 213 + DY++ GR I+ LA++ +E + + +YD+ E + E P Sbjct: 301 MGDYLKATGRDGIASLADSFSEQLRADENAVYDQLIEINLSELEP 345
>TANA_XENLA (Q01550) Tanabin| Length = 1744 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -3 Query: 362 EEMQAVADYIRKHGRVSISHLANNSNEFIDLEPKPLYDEKEESHQDESAPAGIVA 198 EE + DY + ++ L N +EF DL +P E+ +++ D A I + Sbjct: 1389 EEFEISKDYQLEQTLPDVTPLPNLEDEFEDLTEQPDVHEEHQNNDDSGASTFITS 1443 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,236,493 Number of Sequences: 219361 Number of extensions: 1133045 Number of successful extensions: 2718 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2718 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)