Clone Name | rbart59e04 |
---|---|
Clone Library Name | barley_pub |
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 32.7 bits (73), Expect = 0.27 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 26 GQIHRFYTSKLTGSIVTGFTAPQTDGP 106 GQ+H + S++ G+I TGF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>S26A1_RAT (P45380) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) (Canalicular sulfate transporter) (Sulfate/carbonate antiporter) Length = 703 Score = 31.2 bits (69), Expect = 0.79 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 26 GQIHRFYTSKLTGSIVTGFTAPQTDGP 106 GQ+H + S + G+I TGF APQ P Sbjct: 313 GQLHTRFGSSVAGNIPTGFVAPQIPDP 339
>S26A1_HUMAN (Q9H2B4) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 701 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 26 GQIHRFYTSKLTGSIVTGFTAPQTDGP 106 GQ+H+ + S + G I TGF PQ P Sbjct: 309 GQLHKRFGSSVAGDIPTGFMPPQVPEP 335
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 26 GQIHRFYT--SKLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKL 151 G +HR T + +TG+++ F + +T G +DP G + +++ L Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>SYE_SULTO (Q971D0) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 566 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 53 KLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 169 K+ G VT F AP DGPI GN + I K + G Sbjct: 94 KVEGKFVTRF-APNPDGPIHLGNARAAIISYKYAEMYKG 131
>SYE_SULAC (Q4J8P2) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 567 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 56 LTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 169 ++G +VT F AP DGP+ GN + I + R+ G Sbjct: 96 VSGVLVTRF-APNPDGPLHLGNARAAIISHEYARIYNG 132
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 27.7 bits (60), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 97 SLWCCETCDDRPCQFAC 47 SL+CC+ +D CQ AC Sbjct: 213 SLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 27.7 bits (60), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 97 SLWCCETCDDRPCQFAC 47 SL+CC+ +D CQ AC Sbjct: 213 SLYCCDRAEDHACQNAC 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,433,436 Number of Sequences: 219361 Number of extensions: 443601 Number of successful extensions: 1247 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)