Clone Name | rbart59e03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PT127_YEAST (P32606) Putative mitochondrial translation system c... | 29 | 2.5 | 2 | TRPB2_METMA (Q8Q001) Tryptophan synthase beta chain 2 (EC 4.2.1.20) | 28 | 4.3 | 3 | ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41) ... | 28 | 7.4 |
---|
>PT127_YEAST (P32606) Putative mitochondrial translation system component PET127| Length = 800 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 165 KSTVRRCYRHENMHSATAKKQYPAKRTWQARRRTQPRVAPPRNGASVGSHAW 320 K+ +++ YRH+ T YP +RT+ RR R P + S+++ Sbjct: 99 KTNIKKEYRHDKYLERTKVGTYPGRRTYPGRRTYPARRTYPASRTYSDSNSY 150
>TRPB2_METMA (Q8Q001) Tryptophan synthase beta chain 2 (EC 4.2.1.20)| Length = 442 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 231 DTASWPWPSACSHACNTFSLYFFFTLVCNVFI*RSHY 121 +T + W SA S ACN +F L C V++ RS Y Sbjct: 144 ETGAGQWGSALSLACN------YFDLECKVYMVRSSY 174
>ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41)| (Delta(24)-sterol C-methyltransferase) Length = 377 Score = 27.7 bits (60), Expect = 7.4 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +1 Query: 13 TEFYLFSWLTAYYFCTLKRNQRMEEIL 93 T+FY + W T+++FC +++ + + Sbjct: 85 TDFYEYGWSTSFHFCRFAKDESFSQAI 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,982,718 Number of Sequences: 219361 Number of extensions: 961390 Number of successful extensions: 2057 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2055 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)